Name : Recombinant Macaca mulatta α-2-HS-Glycoprotein, AHSG, Fetuin A (C-10His)
Supplier : NOVO
Price :110
SKU : GEN9801181963
| Reacts with | Macaca mulatta |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Macaca mulatta Fetuin A is produced by our Mammalian expression system and the target gene encoding Ala19-Val367 is expressed with a 10His tag at the N-terminus |
| Molecular Weight | 38, 9 kD |
| UniProt number | F6WRS6 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | APHGPGLIYRQPNCDDPETEEAALVAVDYINQNLPWGYKHTLNQIDEVKVWPQQPFGEMFEIEIDTLETTCHVLDPTPVAGCRVRQLKEHAVEGDCDFQLLKVNGKFSVEYAKCDSSPDSAEDVRKVCRDCPLLAPLNDTRVVHAAEAAVTAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTISGTDCVAKEATEAANCNLLAKKQYGFCKATLNEKLGGEEVAVTCTVFQTQPATSQPQPEGANEAVPTPVVDADAPASYPVGASGPLPTGSPIYAHVLAAAPPVVPIHSSHYDLRHLFMGVVSLRSPSGEALHPRKTRSVVQPSVGAAAGPVVPPCPGRVRHFKVHHHHHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Group | recombinants |
| Gene target | AHSG, Fetuin A (C-10His), -2-HS-Glycoprotein, Macaca mulatta &alpha |
| Short name | AHSG, Fetuin A (C-10His), -2-HS-Glycoprotein, Recombinant Macaca mulatta &alpha |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Alternative name | Fetuin A (C-10His), alpha-2-HS-glycoprotein, -2-HS-Glycoprotein, recombinant Macaca mulatta &alpha |
| Alternative technique | rec |
| Alternative to gene target | A2HS and AHS and FETUA and HSGA, AHSG and IDBG-634683 and ENSBTAG00000000522 and 280988, AHSG and IDBG-68916 and ENSG00000145192 and 197, Ahsg and IDBG-148706 and ENSMUSG00000022868 and 11625, Extracellular, kinase inhibitor activity, this GO :0001501 and skeletal system development and biological process this GO :0001503 and ossification and biological process this GO :0004869 and cysteine-type endopeptidase inhibitor activity and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006907 and pinocytosis and biological process this GO :0006953 and acute-phase response and biological process this GO :0010951 and negative regulation of endopeptidase activity and biological process this GO :0019210 and kinase inhibitor activity and molecular function this GO :0030500 and regulation of bone mineralization and biological process this GO :0030502 and negative regulation of bone mineralization and biological process this GO :0042326 and negative regulation of phosphorylation and biological process this GO :0045087 and innate immune response and biological process this GO :0046627 and negative regulation of insulin receptor signaling pathway and biological process this GO :0050727 and regulation of inflammatory response and biological process this GO :0050766 and positive regulation of pha this GO cytosis and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0072562 and blood microparticle and cellular component, this GO :0004869: cysteine-type endopeptidase inhibitor activity, this GO :0004869: cysteine-type endopeptidase inhibitor activity and also this GO :0019210: kinase inhibitor activity, this GO :0019210: kinase inhibitor activity, alpha-2-HS-glycoprotein |
| Identity | 349 |
| Gene | AHSG |
| Long gene name | alpha 2-HS glycoprotein |
| Synonyms | FETUA A2HS HSGA |
| Synonyms name | fetuin A |
| Locus | 3q27, 3 |
| Discovery year | 1986-01-01 |
| GenBank acession | D67013 M16961 |
| Entrez gene record | 197 |
| Pubmed identfication | 9322749 7736783 |
| RefSeq identity | NM_001622 |
| Classification | Cystatins, type 4 |
| Havana BLAST/BLAT | OTTHUMG00000156605 |