| Reacts with | Mouse |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Mouse Activin Receptor IB is produced by our Mammalian expression system and the target gene encoding Leu32-Glu126 is expressed with a Fc tag at the C-terminus |
| Molecular Weight | 37, 7 kD |
| UniProt number | Q61271 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | LLCACTSCLQTNYTCETDGACMVSIFNLDGVEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYIDFCNKIDLRVPSGHLKEPAHPSMWGPVEVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Test | A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or  |
| Latin name | Mus musculus |
| Group | recombinants |
| Gene target | ACVR1B (C-Fc), ALK-4, Activin RIB, Activin Receptor IB |
| Short name | ACVR1B (C-Fc), ALK-4, Activin RIB, Recombinant Mouse Activin Receptor IB |
| Technique | E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Mouses, Mouse |
| Alternative name | Activin RIB, activin A receptor, anaplastic lymphoma receptor tyrosine kinase-4, classification IB (C-fragment c), recombinant Mouse Activin Receptor IB |
| Alternative technique | rec |
| Alternative to gene target | ACTRIB and ACVRLK4 and ALK4 and SKR2, ACVR1B and IDBG-33695 and ENSG00000135503 and 91, ACVR1B and IDBG-632110 and ENSBTAG00000013555 and 539315, ALK and IDBG-42084 and ENSG00000171094 and 238, ALK and IDBG-636042 and ENSBTAG00000007379 and 536642, Acvr1b and IDBG-185560 and ENSMUSG00000000532 and 11479, Alk and IDBG-197259 and ENSMUSG00000055471 and 11682, CD246 and NBLST3, Cell surfaces, DNA-templated and biological process this GO :0006468 and protein phosphorylation and biological process this GO :0007165 and signal transduction and biological process this GO :0007178 and transmembrane receptor protein serine/threonine kinase signaling pathway and biological process this GO :0007417 and central nervous system development and biological process this GO :0009966 and regulation of signal transduction and biological process this GO :0009986 and cell surface and cellular component this GO :0010862 and positive regulation of pathway-restricted SMAD protein phosphorylation and biological process this GO :0016020 and membrane and cellular component this GO :0016361 and activin receptor activity, Plasma membranes, activin receptor activity, anaplastic lymphoma receptor tyrosine kinase, this GO :0000082 and G1/S transition of mitotic cell cycle and biological process this GO :0001701 and in utero embryonic development and biological process this GO :0001942 and hair follicle development and biological process this GO :0004672 and protein kinase activity and molecular function this GO :0004674 and protein serine/threonine kinase activity and molecular function this GO :0004675 and transmembrane receptor protein serine/threonine kinase activity and molecular function this GO :0004702 and receptor signaling protein serine/threonine kinase activity and molecular function this GO :0004713 and protein tyrosine kinase activity and molecular function this GO :0005024 and transforming growth factor beta-activated receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005524 and ATP binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006355 and regulation of transcription, this GO :0000187 and activation of MAPK activity and biological process this GO :0004672 and protein kinase activity and molecular function this GO :0004704 and NF-kappaB-inducing kinase activity and molecular function this GO :0004713 and protein tyrosine kinase activity and molecular function this GO :0004714 and transmembrane receptor protein tyrosine kinase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005524 and ATP binding and molecular function this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006468 and protein phosphorylation and biological process this GO :0007165 and signal transduction and biological process this GO :0007169 and transmembrane receptor protein tyrosine kinase signaling pathway and biological process this GO :0007399 and nervous system development and biological process this GO :0008283 and cell proliferation and biological process this GO :0016020 and membrane and cellular component this GO :0016310 and phosphorylation and biological process this GO :0016772 and transferase activity, this GO :0004672: protein kinase activity, this GO :0004672: protein kinase activity, this GO :0004672: protein kinase activity and also this GO :0004674: protein serine/threonine kinase activity and also this GO :0004675: transmembrane receptor protein serine/threonine kinase activity and also this GO :0004702: receptor signaling protein serine/threonine kinase activity and also this GO :0004713: protein tyrosine kinase activity and also this GO :0005024: transforming growth factor beta-activated receptor activity and also this GO :0005515: protein binding and also this GO :0005524: ATP binding and also this GO :0016361: activin receptor activity, this GO :0004672: protein kinase activity and also this GO :0004704: NF-kappaB-inducing kinase activity and also this GO :0004713: protein tyrosine kinase activity and also this GO :0004714: transmembrane receptor protein tyrosine kinase activity and also this GO :0005515: protein binding and also this GO :0005524: ATP binding and also this GO :0016772: transferase activity, this GO :0004674: protein serine/threonine kinase activity, this GO :0004675: transmembrane receptor protein serine/threonine kinase activity, this GO :0004702: receptor signaling protein serine/threonine kinase activity, this GO :0004704: NF-kappaB-inducing kinase activity, this GO :0004713: protein tyrosine kinase activity, this GO :0004713: protein tyrosine kinase activity, this GO :0004714: transmembrane receptor protein tyrosine kinase activity, this GO :0005024: transforming growth factor beta-activated receptor activity, this GO :0005515: protein binding, this GO :0005515: protein binding, this GO :0005524: ATP binding, this GO :0005524: ATP binding, this GO :0016361: activin receptor activity, this GO :0016772: transferase activity, this GO :0016772: transferase activity, this GO :0017002: activin-activated receptor activity, this GO :0019838: growth factor binding, this GO :0031625: ubiquitin protein ligase binding, this GO :0034711: inhibin binding, this GO :0046332: SMAD binding, this GO :0046872: metal ion binding, this GO :0048185: activin binding, transferase activity, transferring phosphorus-containing groups, transferring phosphorus-containing groups, transferring phosphorus-containing groups, transferring phosphorus-containing groups and also this GO :0017002: activin-activated receptor activity and also this GO :0019838: growth factor binding and also this GO :0031625: ubiquitin protein ligase binding and also this GO :0034711: inhibin binding and also this GO :0046332: SMAD binding and also this GO :0046872: metal ion binding and also this GO :0048185: activin binding, transferring phosphorus-containing groups and molecular function this GO :0017002 and activin-activated receptor activity and molecular function this GO :0018107 and peptidyl-threonine phosphorylation and biological process this GO :0019838 and growth factor binding and molecular function this GO :0030308 and negative regulation of cell growth and biological process this GO :0031625 and ubiquitin protein ligase binding and molecular function this GO :0032924 and activin receptor signaling pathway and biological process this GO :0032927 and positive regulation of activin receptor signaling pathway and biological process this GO :0034711 and inhibin binding and molecular function this GO :0038092 and nodal signaling pathway and biological process this GO :0045648 and positive regulation of erythrocyte differentiation and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0046332 and SMAD binding and molecular function this GO :0046545 and development of primary female sexual characteristics and biological process this GO :0046777 and protein autophosphorylation and biological process this GO :0046872 and metal ion binding and molecular function this GO :0048185 and activin binding and molecular function this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0097191 and extrinsic apoptotic signaling pathway and biological process this GO :1901165 and positive regulation of trophoblast cell migration and biological process, transferring phosphorus-containing groups and molecular function this GO :0018108 and peptidyl-tyrosine phosphorylation and biological process this GO :0038061 and NIK/NF-kappaB signaling and biological process this GO :0042981 and regulation of apoptotic process and biological process this GO :0043234 and protein complex and cellular component this GO :0046777 and protein autophosphorylation and biological process this GO :0048666 and neuron development and biological process this GO :0051092 and positive regulation of NF-kappaB transcription factor activity and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, type I, type I and also this GO :0016772: transferase activity, type I and molecular function this GO :0016772 and transferase activity, type IB, activin A receptor |
| Identity | 172 |
| Gene | ACVR1B |
| Long gene name | activin A receptor type 1B |
| Synonyms gene | ACVRLK4 |
| Synonyms gene name | activin A receptor, type IB |
| Synonyms | ALK4 SKR2 ActRIB |
| Locus | 12q13, 13 |
| Discovery year | 1994-12-12 |
| Entrez gene record | 91 |
| Pubmed identfication | 8397373 |
| RefSeq identity | NM_020328 |
| Classification | Type 1 receptor serine/threonine kinases |
| Havana BLAST/BLAT | OTTHUMG00000167920 |