| Reacts with | Mouse |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Mouse C-C motif Chemokine 2 is produced by our E, coli expression system and the target gene encoding Gln24-Arg96 is expressed |
| Molecular Weight | 5 kD, 8 |
| UniProt number | P10148 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMR |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Test | A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or  |
| Latin name | Mus musculus |
| Group | recombinants |
| Gene target | CCL2, C-C motif chemokine 2 |
| Short name | CCL2, Recombinant Mouse C-C motif chemokine 2 |
| Technique | E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Mouses, Mouse |
| Alternative name | chemokine (C-C motif) ligand 2, recombinant Mouse C-C motif chemokine 2 |
| Alternative technique | rec |
| Alternative to gene target | CCL2 and IDBG-40504 and ENSG00000108691 and 6347, CCL2 and IDBG-630954 and ENSBTAG00000037811 and 281043, CCR2 chemokine receptor binding, Ccl2 and IDBG-204473 and ENSMUSG00000035385 and 20296, Extracellular, GDCF-2 and HC11 and HSMCR30 and MCAF and MCP-1 and MCP1 and SCYA2 and SMC-CF, coupled to cyclic nucleotide second messenger and biological process this GO :0007259 and JAK-STAT cascade and biological process this GO :0007568 and aging and biological process this GO :0008009 and chemokine activity and molecular function this GO :0008201 and heparin binding and molecular function this GO :0008347 and glial cell migration and biological process this GO :0008360 and regulation of cell shape and biological process this GO :0009408 and response to heat and biological process this GO :0009611 and response to wounding and biological process this GO :0009612 and response to mechanical stimulus and biological process this GO :0009617 and response to bacterium and biological process this GO :0009887 and organ morphogenesis and biological process this GO :0010332 and response to gamma radiation and biological process this GO :0010574 and regulation of vascular endothelial growth factor production and biological process this GO :0010759 and positive regulation of macrophage chemotaxis and biological process this GO :0014823 and response to activity and biological process this GO :0016525 and negative regulation of angiogenesis and biological process this GO :0019079 and viral genome replication and biological process this GO :0019221 and cytokine-mediated signaling pathway and biological process this GO :0019725 and cellular homeostasis and biological process this GO :0022409 and positive regulation of cell-cell adhesion and biological process this GO :0030139 and endocytic vesicle and cellular component this GO :0030425 and dendrite and cellular component this GO :0030593 and neutrophil chemotaxis and biological process this GO :0030968 and endoplasmic reticulum unfolded protein response and biological process this GO :0031100 and organ regeneration and biological process this GO :0031663 and lipopolysaccharide-mediated signaling pathway and biological process this GO :0031727 and CCR2 chemokine receptor binding and molecular function this GO :0032496 and response to lipopolysaccharide and biological process this GO :0032570 and response to progesterone and biological process this GO :0032760 and positive regulation of tumor necrosis factor production and biological process this GO :0032869 and cellular response to insulin stimulus and biological process this GO :0032967 and positive regulation of collagen biosynthetic process and biological process this GO :0033552 and response to vitamin B3 and biological process this GO :0034351 and negative regulation of glial cell apoptotic process and biological process this GO :0035684 and helper T cell extravasation and biological process this GO :0035690 and cellular response to drug and biological process this GO :0036006 and cellular response to macrophage colony-stimulating factor stimulus and biological process this GO :0036120 and cellular response to platelet-derived growth factor stimulus and biological process this GO :0042493 and response to drug and biological process this GO :0043025 and neuronal cell body and cellular component this GO :0043200 and response to amino acid and biological process this GO :0043204 and perikaryon and cellular component this GO :0043491 and protein kinase B signaling and biological process this GO :0043524 and negative regulation of neuron apoptotic process and biological process this GO :0043615 and astrocyte cell migration and biological process this GO :0043679 and axon terminus and cellular component this GO :0044267 and cellular protein metabolic process and biological process this GO :0044299 and C-fiber and cellular component this GO :0044344 and cellular response to fibroblast growth factor stimulus and biological process this GO :0045087 and innate immune response and biological process this GO :0045202 and synapse and cellular component this GO :0045471 and response to ethanol and biological process this GO :0045785 and positive regulation of cell adhesion and biological process this GO :0046677 and response to antibiotic and biological process this GO :0048010 and vascular endothelial growth factor receptor signaling pathway and biological process this GO :0048246 and macrophage chemotaxis and biological process this GO :0048247 and lymphocyte chemotaxis and biological process this GO :0048471 and perinuclear region of cytoplasm and cellular component this GO :0050806 and positive regulation of synaptic transmission and biological process this GO :0050870 and positive regulation of T cell activation and biological process this GO :0051384 and response to glucocorticoid and biological process this GO :0051770 and positive regulation of nitric-oxide synthase biosynthetic process and biological process this GO :0060135 and maternal process involved in female pregnancy and biological process this GO :0060137 and maternal process involved in parturition and biological process this GO :0060326 and cell chemotaxis and biological process this GO :0070098 and chemokine-mediated signaling pathway and biological process this GO :0071222 and cellular response to lipopolysaccharide and biological process this GO :0071300 and cellular response to retinoic acid and biological process this GO :0071318 and cellular response to ATP and biological process this GO :0071346 and cellular response to interferon-gamma and biological process this GO :0071347 and cellular response to interleukin-1 and biological process this GO :0071354 and cellular response to interleukin-6 and biological process this GO :0071356 and cellular response to tumor necrosis factor and biological process this GO :0071402 and cellular response to lipoprotein particle stimulus and biological process this GO :0071403 and cellular response to high density lipoprotein particle stimulus and biological process this GO :0071407 and cellular response to organic cyclic compound and biological process this GO :0071549 and cellular response to dexamethasone stimulus and biological process this GO :0090026 and positive regulation of monocyte chemotaxis and biological process this GO :0090265 and positive regulation of immune complex clearance by monocytes and macrophages and biological process this GO :0090280 and positive regulation of calcium ion import and biological process this GO :2000427 and positive regulation of apoptotic cell clearance and biological process this GO :2000502 and negative regulation of natural killer cell chemotaxis and biological process, this GO :0000165 and MAPK cascade and biological process this GO :0001525 and angiogenesis and biological process this GO :0001664 and G-protein coupled receptor binding and molecular function this GO :0001666 and response to hypoxia and biological process this GO :0001912 and positive regulation of leukocyte mediated cytotoxicity and biological process this GO :0001938 and positive regulation of endothelial cell proliferation and biological process this GO :0002523 and leukocyte migration involved in inflammatory response and biological process this GO :0002548 and monocyte chemotaxis and biological process this GO :0002687 and positive regulation of leukocyte migration and biological process this GO :0002693 and positive regulation of cellular extravasation and biological process this GO :0004672 and protein kinase activity and molecular function this GO :0005102 and receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005791 and rough endoplasmic reticulum and cellular component this GO :0006468 and protein phosphorylation and biological process this GO :0006874 and cellular calcium ion homeostasis and biological process this GO :0006935 and chemotaxis and biological process this GO :0006954 and inflammatory response and biological process this GO :0006955 and immune response and biological process this GO :0006959 and humoral immune response and biological process this GO :0006987 and activation of signaling protein activity involved in unfolded protein response and biological process this GO :0007010 and cytoskeleton organization and biological process this GO :0007155 and cell adhesion and biological process this GO :0007165 and signal transduction and biological process this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0007179 and transforming growth factor beta receptor signaling pathway and biological process this GO :0007186 and G-protein coupled receptor signaling pathway and biological process this GO :0007187 and G-protein coupled receptor signaling pathway, this GO :0001664: G-protein coupled receptor binding, this GO :0001664: G-protein coupled receptor binding and also this GO :0004672: protein kinase activity and also this GO :0005102: receptor binding and also this GO :0005515: protein binding and also this GO :0008009: chemokine activity and also this GO :0008201: heparin binding and also this GO :0031727: CCR2 chemokine receptor binding, this GO :0004672: protein kinase activity, this GO :0005102: receptor binding, this GO :0005515: protein binding, this GO :0008009: chemokine activity, this GO :0008201: heparin binding, this GO :0031727: CCR2 chemokine receptor binding, chemokine (C-C motif) ligand 2 |
| Identity | 10618 |
| Gene | CCL2 |
| Long gene name | C-C motif chemokine ligand 2 |
| Synonyms gene | SCYA2 |
| Synonyms gene name | homologous to mouse Sig-je) chemokine (C-C motif) ligand 2 , small inducible cytokine A2 (monocyte chemotactic protein 1 |
| Synonyms | MCP1 MCP-1 MCAF SMC-CF GDCF-2 HC11 MGC9434 |
| Synonyms name | homologous to mouse Sig-je monocyte chemoattractant protein-1 monocyte chemotactic and activating factor monocyte secretory protein JE small inducible cytokine subfamily A (Cys-Cys), member 2 , monocyte chemotactic protein 1 |
| Locus | 17q12 |
| Discovery year | 1990-07-05 |
| GenBank acession | BC009716 |
| Entrez gene record | 6347 |
| Pubmed identfication | 2004761 |
| RefSeq identity | NM_002982 |
| Classification | Endogenous ligands Chemokine ligands |
| Havana BLAST/BLAT | OTTHUMG00000132887 |