Name : Recombinant Mouse C-X-C Motif Chemokine 16, CXCL16, SR-PSOX (C-6His)
Supplier : NOVO
Price :2283
SKU : GEN4857674402
| Reacts with | Mouse |
| Source | proteins, Recombinants or rec |
| Description | chemokine receptors, ligands , motif chemokines and cytokines are supplied by novo in 1, Chemokines |
| Molecular Weight | 1 kD, 20 |
| UniProt number | Q8BSU2 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | pH 7, 2 um filtered solution of phosphate buffered saline, 4 , Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLPQASTQTPEAAEGTPSDTSTPAHSQSTQHSTLPSGALSLNKEHTQPWEMTTLPSGYGLEARPEAEANEKQQDDRQQEAPGAGASTPAWVDHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Test | A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or  |
| Latin name | Mus musculus |
| Group | recombinants |
| Gene target | CXCL16, SR-PSOX (C-6His), C-X-C Motif Chemokine 16 |
| Short name | CXCL16, SR-PSOX (C-6His), Recombinant Mouse C-X-C Motif Chemokine 16 |
| Technique | E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Mouses, Mouse |
| Alternative name | SR-PSOX (C-6His), chemokine (C-X-C motif) ligand 16, recombinant Mouse C-X-C Motif Chemokine 16 |
| Alternative technique | rec |
| Alternative to gene target | CXCL16 and IDBG-19403 and ENSG00000161921 and 58191, CXCL16 and IDBG-634352 and ENSBTAG00000031998 and 511671, Cxcl16 and IDBG-194380 and ENSMUSG00000018920 and 66102, Extracellular, chemokine activity, this GO :0005041 and low-density lipoprotein receptor activity and molecular function this GO :0005044 and scavenger receptor activity and molecular function this GO :0005102 and receptor binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006898 and receptor-mediated endocytosis and biological process this GO :0006935 and chemotaxis and biological process this GO :0008009 and chemokine activity and molecular function this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0030307 and positive regulation of cell growth and biological process this GO :0030335 and positive regulation of cell migration and biological process this GO :0034097 and response to cytokine and biological process this GO :0034341 and response to interferon-gamma and biological process this GO :0034612 and response to tumor necrosis factor and biological process this GO :0048247 and lymphocyte chemotaxis and biological process, this GO :0005041: low-density lipoprotein receptor activity, this GO :0005041: low-density lipoprotein receptor activity and also this GO :0005044: scavenger receptor activity and also this GO :0005102: receptor binding and also this GO :0008009: chemokine activity, this GO :0005044: scavenger receptor activity, this GO :0005102: receptor binding, this GO :0008009: chemokine activity, chemokine (C-X-C motif) ligand 16 |
| Identity | 16642 |
| Gene | CXCL16 |
| Long gene name | C-X-C motif chemokine ligand 16 |
| Synonyms gene name | chemokine (C-X-C motif) ligand 16 |
| Synonyms | SR-PSOX CXCLG16 SRPSOX |
| Synonyms name | CXC chemokine ligand 16 |
| Locus | 17p13, 2 |
| Discovery year | 2001-09-21 |
| GenBank acession | AF275260 |
| Entrez gene record | 58191 |
| Pubmed identfication | 11017100 11060282 |
| RefSeq identity | NM_022059 |
| Classification | Endogenous ligands Chemokine ligands Scavenger receptors |
| Havana BLAST/BLAT | OTTHUMG00000090761 |