Name : Recombinant Mouse Carbonic Anhydrase 14, CA14 (C-6His)
Supplier : NOVO
Price :202
SKU : GEN8880982386
| Reacts with | Mouse |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Mouse Carbonic anhydrase 14 is produced by our Mammalian expression system and the target gene encoding Ala16-Met290 is expressed with a 6His tag at the C-terminus |
| Molecular Weight | 31, 8 kD |
| UniProt number | Q9WVT6 |
| State of the product | Liquid |
| Shipping conditions | Dry Ice/ice packs |
| Formulation | 150 mM sodium chloride, 2 um filtered solution of 20 mM Tris, Supplied as a 0, pH8 |
| Storage recommendations | -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | ADGGHHWTYEGPHGQDHWPTSYPECGGDAQSPINIQTDSVIFDPDLPAVQPHGYDQLGTEPLDLHNNGHTVQLSLPPTLHLGGLPRKYTAAQLHLHWGQRGSLEGSEHQINSEATAAELHVVHYDSQSYSSLSEAAQKPQGLAVLGILIEVGETENPAYDHILSRLHEIRYKDQKTSVPPFSVRELFPQQLEQFFRYNGSLTTPPCYQSVLWTVFNRRAQISMGQLEKLQETLSSTEEDPSEPLVQNYRVPQPLNQRTIFASFIQAGPLYTTGEMVDHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Test | A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or  |
| Latin name | Mus musculus |
| Group | recombinants |
| Gene target | CA14 (C-6His), Carbonic Anhydrase 14 |
| Short name | CA14 (C-6His), Recombinant Mouse Carbonic Anhydrase 14 |
| Technique | E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Mouses, Mouse |
| Alternative name | CA14 (C-6His), recombinant Mouse Carbonic Anhydrase 14 |
| Alternative technique | rec |
| Identity | 1372 |
| Gene | CA14 |
| Long gene name | carbonic anhydrase 14 |
| Synonyms gene name | carbonic anhydrase XIV |
| Locus | 1q21, 2 |
| Discovery year | 1999-11-16 |
| GenBank acession | AB025904 |
| Entrez gene record | 23632 |
| Pubmed identfication | 10512682 |
| RefSeq identity | NM_012113 |
| Classification | Carbonic anhydrases |
| Havana BLAST/BLAT | OTTHUMG00000012549 |