Name : Recombinant Mouse Cathepsin B, CTSB (C-6His)
Supplier : NOVO
Price :496
SKU : GEN5629058409
| Reacts with | Mouse |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Mouse Cathepsin B is produced by our Mammalian expression system and the target gene encoding His18-Phe339 is expressed with a 6His tag at the C-terminus |
| Molecular Weight | 36, 4 kD |
| UniProt number | P10605 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | HDKPSFHPLSDDLINYINKQNTTWQAGRNFYNVDISYLKKLCGTVLGGPKLPGRVAFGEDIDLPETFDAREQWSNCPTIGQIRDQGSCGSCWAFGAVEAISDRTCIHTNGRVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWSFWTKKGLVSGGVYNSHVGCLPYTIPPCEHHVNGSRPPCTGEGDTPRCNKSCEAGYSPSYKEDKHFGYTSYSVSNSVKEIMAEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAGDMMGGHAIRILGWGVENGVPYWLAANSWNLDWGDNGFFKILRGENHCGIESEIVAGIPRTDQYWGRFVDHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Gene | CTSB |
| Test | A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or  |
| Latin name | Mus musculus |
| Group | recombinants |
| Gene target | CTSB (C-6His), Cathepsin B |
| Short name | CTSB (C-6His), Recombinant Mouse Cathepsin B |
| Technique | E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Mouses, Mouse |
| Alternative name | cathepsin B (C-6His), recombinant Mouse Cathepsin B |
| Alternative technique | rec |
| Alternative to gene target | APPS and CPSB, CTSB and IDBG-629395 and ENSBTAG00000012442 and 281105, CTSB and IDBG-7654 and ENSG00000164733 and 1508, Ctsb and IDBG-172314 and ENSMUSG00000021939 and 13030, nuclei, proteoglycan binding, this GO :0002224 and toll-like receptor signaling pathway and biological process this GO :0004197 and cysteine-type endopeptidase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005518 and collagen binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005622 and intracellular and cellular component this GO :0005730 and nucleolus and cellular component this GO :0005739 and mitochondrion and cellular component this GO :0005764 and lysosome and cellular component this GO :0006508 and proteolysis and biological process this GO :0008233 and peptidase activity and molecular function this GO :0008234 and cysteine-type peptidase activity and molecular function this GO :0022617 and extracellular matrix disassembly and biological process this GO :0030198 and extracellular matrix organization and biological process this GO :0030574 and collagen catabolic process and biological process this GO :0030855 and epithelial cell differentiation and biological process this GO :0036021 and endolysosome lumen and cellular component this GO :0042470 and melanosome and cellular component this GO :0042981 and regulation of apoptotic process and biological process this GO :0043231 and intracellular membrane-bounded organelle and cellular component this GO :0043394 and proteoglycan binding and molecular function this GO :0045087 and innate immune response and biological process this GO :0046697 and decidualization and biological process this GO :0048471 and perinuclear region of cytoplasm and cellular component this GO :0050790 and regulation of catalytic activity and biological process this GO :0051603 and proteolysis involved in cellular protein catabolic process and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0097067 and cellular response to thyroid hormone stimulus and biological process, this GO :0004197: cysteine-type endopeptidase activity, this GO :0004197: cysteine-type endopeptidase activity and also this GO :0005515: protein binding and also this GO :0005518: collagen binding and also this GO :0008233: peptidase activity and also this GO :0008234: cysteine-type peptidase activity and also this GO :0043394: proteoglycan binding, this GO :0005515: protein binding, this GO :0005518: collagen binding, this GO :0008233: peptidase activity, this GO :0008234: cysteine-type peptidase activity, this GO :0043394: proteoglycan binding, cathepsin B |
| Identity | 2527 |
| Long gene name | cathepsin B |
| Locus | 8p23, 1 |
| Discovery year | 2001-06-22 |
| GenBank acession | M14221 |
| Entrez gene record | 1508 |
| Pubmed identfication | 8112600 3463996 |
| RefSeq identity | NM_147780 |
| Classification | Cathepsins |
| Havana BLAST/BLAT | OTTHUMG00000090799 |