Name : Recombinant Mouse CD27, TNFRSF7 (C-Fc-6His)
Supplier : NOVO
Price :659
SKU : GEN7003433608
| Reacts with | Mouse |
| Source | proteins, Recombinants or rec |
| Description | 6His tag at the C-terminus, Recombinant Mouse CD27 antigen is produced by our expression system and the target gene encoding Pro24-Arg182 is expressed with a Fc |
| Molecular Weight | 45, 8 kD |
| UniProt number | P41272 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | PNSCPDKHYWTGGGLCCRMCEPGTFFVKDCEQDRTAAQCDPCIPGTSFSPDYHTRPHCESCRHCNSGFLIRNCTVTANAECSCSKNWQCRDQECTECDPPLNPALTRQPSETPSPQPPPTHLPHGTEKPSWPLHRQLPNSTVYSQRSSHRPLCSSDCIRVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Test | A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or  |
| Latin name | Mus musculus |
| Group | recombinants |
| Gene target | TNFRSF7 (C-Fc-6His), CD27 |
| Short name | TNFRSF7 (C-Fc-6His), Recombinant Mouse CD27 |
| Technique | E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Mouses, Mouse |
| Alternative name | TNFRSF7 (C-fragment c-6His), recombinant Mouse CD27 molecule |
| Alternative technique | rec |
| Alternative to gene target | CD27 and IDBG-14014 and ENSG00000139193 and 939, CD27 and IDBG-640494 and ENSBTAG00000014725 and 512514, Cd27 and IDBG-189750 and ENSMUSG00000030336 and 21940, Extracellular, LPFS2 and T14 and TNFRSF7 and Tp55, S152 and S152, cysteine-type endopeptidase inhibitor activity involved in apoptotic process, this GO :0004888 and transmembrane signaling receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0008588 and release of cytoplasmic sequestered NF-kappaB and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0009986 and cell surface and cellular component this GO :0016020 and membrane and cellular component this GO :0016064 and immunoglobulin mediated immune response and biological process this GO :0043027 and cysteine-type endopeptidase inhibitor activity involved in apoptotic process and molecular function this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0043154 and negative regulation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0045087 and innate immune response and biological process this GO :0045471 and response to ethanol and biological process this GO :0045579 and positive regulation of B cell differentiation and biological process this GO :0046330 and positive regulation of JNK cascade and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0070233 and negative regulation of T cell apoptotic process and biological process this GO :0097191 and extrinsic apoptotic signaling pathway and biological process, this GO :0004888: transmembrane signaling receptor activity, this GO :0004888: transmembrane signaling receptor activity and also this GO :0005515: protein binding and also this GO :0043027: cysteine-type endopeptidase inhibitor activity involved in apoptotic process, this GO :0005515: protein binding, this GO :0043027: cysteine-type endopeptidase inhibitor activity involved in apoptotic process, CD27 molecule |
| Identity | 11922 |
| Gene | CD27 |
| Long gene name | CD27 molecule |
| Synonyms gene | TNFRSF7 |
| Synonyms gene name | member 7 , tumor necrosis factor receptor superfamily |
| Synonyms | S152 Tp55 |
| Locus | 12p13, 31 |
| Discovery year | 1992-06-10 |
| GenBank acession | M63928 |
| Entrez gene record | 939 |
| Pubmed identfication | 2442250 8530100 |
| Classification | CD molecules Tumor necrosis factor receptor superfamily |
| Havana BLAST/BLAT | OTTHUMG00000168316 |
| Locus Specific Databases | LRG_357 |