Name : Recombinant Mouse CD5, Leu-1 (C-6His)
Supplier : NOVO
Price :1613
SKU : GEN9610506227
| Reacts with | Mouse |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Mouse CD5 is produced by our Mammalian expression system and the target gene encoding Gln24-Asn370 is expressed with a 6His tag at the C-terminus |
| Molecular Weight | 38, 9 kD |
| UniProt number | P13379 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | pH 7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | QSGRGGLDIQVMLSGSNSKCQGQVEIQMENKWKTVCSSSWRLSQDHSKNAQQASAVCKQLRCGDPLALGPFPSLNRPQNQVFCQGSPWSISNCNNTSSQDQCLPLSLICLEPQRTTPPPTTTPPTTVPEPTAPPRLQLVPGHEGLRCTGVVEFYNGSWGGTILYKAKDRPLGLGNLICKSLQCGSFLTHLSGTEAAGTPAPAELRDPRPLPIRWEAPNGSCVSLQQCFQKTTAQEGGQALTVICSDFQPKVQSRLVGGSSVCEGIAEVRQRSQWEALCDSSAARGRGRWEELCREQQCGDLISFHTVDADKTSPGFLCAQEKLSQCYHLQKKKHCNKRVFVTCQDPNVDHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Test | A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or  |
| Latin name | Mus musculus |
| Group | recombinants |
| Gene target | Leu-1 (C-6His), CD5 |
| Short name | Leu-1 (C-6His), Recombinant Mouse CD5 |
| Technique | E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Mouses, Mouse |
| Alternative name | L-leucine-1 (C-6His), recombinant Mouse CD5 molecule |
| Alternative technique | rec |
| Alternative to gene target | CD5 and IDBG-49730 and ENSG00000110448 and 921, CD5 and IDBG-643103 and ENSBTAG00000013730 and 280745, Cd5 and IDBG-144910 and ENSMUSG00000024669 and 12507, Cell surfaces, LEU1 and T1, protein binding, this GO :0004872 and receptor activity and molecular function this GO :0004888 and transmembrane signaling receptor activity and molecular function this GO :0005044 and scavenger receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006898 and receptor-mediated endocytosis and biological process this GO :0008037 and cell recognition and biological process this GO :0008283 and cell proliferation and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0016020 and membrane and cellular component this GO :0031295 and T cell costimulation and biological process this GO :0097190 and apoptotic signaling pathway and biological process, this GO :0004872: receptor activity, this GO :0004872: receptor activity and also this GO :0004888: transmembrane signaling receptor activity and also this GO :0005044: scavenger receptor activity and also this GO :0005515: protein binding, this GO :0004888: transmembrane signaling receptor activity, this GO :0005044: scavenger receptor activity, this GO :0005515: protein binding, CD5 molecule |
| Identity | 1685 |
| Gene | CD5 |
| Long gene name | CD5 molecule |
| Synonyms gene | LEU1 |
| Synonyms gene name | CD5 antigen (p56-62) |
| Synonyms | T1 |
| Locus | 11q12, 2 |
| Discovery year | 1986-01-01 |
| GenBank acession | X04391 |
| Entrez gene record | 921 |
| Pubmed identfication | 1711157 |
| RefSeq identity | NM_014207 |
| Classification | CD molecules |
| Havana BLAST/BLAT | OTTHUMG00000167825 |