Name : Recombinant Mouse Cystatin E, CST6 (C-6His)
Supplier : NOVO
Price :202
SKU : GEN2724066611
| Reacts with | Mouse |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Mouse Cystatin E/M is produced by our Mammalian expression system and the target gene encoding Glu29-Val149 is expressed with a 6His tag at the C-terminus |
| Molecular Weight | 14, 8 kD |
| UniProt number | Q9D1B1 |
| State of the product | Liquid |
| Shipping conditions | Dry Ice/ice packs |
| Formulation | 150 mM sodium chloride, 2 um filtered solution of 20 mM MES, 4, Supplied as a 0, pH 7 |
| Storage recommendations | -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | ELRSRRTGERQNLSPTDPRVQKAAQAAVASYNMGSDSLYYFRDTKVIDAKYQLVAGIKYYLTLDIESTECRKTRVSGEHMDLTTCPLAAGGQQEKLRCNFELLEVPWKNTTQLLKHDCVQVVDHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Test | A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or  |
| Latin name | Mus musculus |
| Group | recombinants |
| Gene target | CST6 (C-6His), Cystatin E |
| Short name | CST6 (C-6His), Recombinant Mouse Cystatin E |
| Technique | E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Mouses, Mouse |
| Alternative name | CST6 (C-6His), recombinant Mouse Cystatin E |
| Alternative technique | rec |
| Identity | 2478 |
| Gene | CST6 |
| Long gene name | cystatin E/M |
| Locus | 11q13, 1 |
| Discovery year | 1996-12-12 |
| GenBank acession | U62800 |
| Entrez gene record | 1474 |
| Pubmed identfication | 9154125 9099741 |
| RefSeq identity | NM_001323 |
| Classification | Cystatins, type 2 |
| Havana BLAST/BLAT | OTTHUMG00000166750 |