Name : Recombinant Mouse DNAX Accessory Molecule-1, DNAM-1, CD226 (C-6His)
Supplier : NOVO
Price :1613
SKU : GEN7398864097
| Reacts with | Mouse |
| Source | proteins, Recombinants or rec |
| Description | present in lysates used as reference for ELISA quantification of these molecules and their subunits, Whole adhesion and interacting molecules are  |
| Molecular Weight | 27, 6 kD |
| UniProt number | Q8K4F0 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | EETLWDTTVRLSETMTLECVYPLTHNLTQVEWTKNTGTKTVSIAVYNPNHNMHIESNYLHRVHFLNSTVGFRNMSLSFYNASEADIGIYSCLFHAFPNGPWEKKIKVVWSDSFEIAAPSDSYLSAEPGQDVTLTCQLPRTWPVQQVIWEKVQPHQVDILASCNLSQETRYTSKYLRQTRSNCSQGSMKSILIIPNAMAADSGLYRCRSEAITGKNKSFVIRLIITDGGTNKHFILPHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Test | A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or  |
| Latin name | Mus musculus |
| Group | recombinants |
| Gene target | CD226 (C-6His), DNAM-1, DNAX Accessory Molecule-1 |
| Short name | CD226 (C-6His), DNAM-1, Recombinant Mouse DNAX Accessory Molecule-1 |
| Technique | E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Mouses, Mouse |
| Alternative name | CD226 molecule (C-6His), DNAM-1, recombinant Mouse DNAX Accessory Molecule-1 |
| Alternative technique | rec |
| Alternative to gene target | CD226 and IDBG-4779 and ENSG00000150637 and 10666, CD226 and IDBG-643547 and ENSBTAG00000009266 and 615496, Cd226 and IDBG-163478 and ENSMUSG00000034028 and 225825, Cell surfaces, DNAM-1 and DNAM1 and PTA1 and TLiSA1, cell adhesion molecule binding, this GO :0001816 and cytokine production and biological process this GO :0002860 and positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target and biological process this GO :0002891 and positive regulation of immunoglobulin mediated immune response and biological process this GO :0005178 and integrin binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0007155 and cell adhesion and biological process this GO :0007165 and signal transduction and biological process this GO :0008037 and cell recognition and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0009986 and cell surface and cellular component this GO :0019901 and protein kinase binding and molecular function this GO :0033005 and positive regulation of mast cell activation and biological process this GO :0045121 and membrane raft and cellular component this GO :0045954 and positive regulation of natural killer cell mediated cytotoxicity and biological process this GO :0050776 and regulation of immune response and biological process this GO :0050839 and cell adhesion molecule binding and molecular function this GO :0060369 and positive regulation of Fc receptor mediated stimulatory signaling pathway and biological process, this GO :0005178: integrin binding, this GO :0005178: integrin binding and also this GO :0005515: protein binding and also this GO :0019901: protein kinase binding and also this GO :0050839: cell adhesion molecule binding, this GO :0005515: protein binding, this GO :0019901: protein kinase binding, this GO :0050839: cell adhesion molecule binding, CD226 molecule |
| Identity | 16961 |
| Gene | CD226 |
| Long gene name | CD226 molecule |
| Synonyms gene name | CD226 antigen |
| Synonyms | DNAM-1 DNAM1 PTA1 TLiSA1 |
| Locus | 18q22, 2 |
| Discovery year | 2003-10-02 |
| GenBank acession | U56102 |
| Entrez gene record | 10666 |
| Pubmed identfication | 8673704 |
| RefSeq identity | NM_006566 |
| Classification | CD molecules V-set domain containing |
| Havana BLAST/BLAT | OTTHUMG00000132809 |