Name : Recombinant Mouse Fas, TNFRSF6, CD95 (C-Fc)
Supplier : NOVO
Price :146
SKU : GEN9062774677
| Reacts with | Mouse |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Mouse Apoptosis-mediating Surface Antigen FAS is produced by our expression system and the target gene encoding Gln22-Arg169 is expressed with a Fc tag at the C-terminus |
| Molecular Weight | 43, 7 kD |
| UniProt number | P25446 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | QGTNSISESLKLRRRVRETDKNCSEGLYQGGPFCCQPCQPGKKKVEDCKMNGGTPTCAPCTEGKEYMDKNHYADKCRRCTLCDEEHGLEVETNCTLTQNTKCKCKPDFYCDSPGCEHCVRCASCEHGTLEPCTATSNTNCRKQSPRNRVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Test | A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or  |
| Latin name | Mus musculus |
| Group | recombinants |
| Gene target | CD95 (C-Fc), TNFRSF6, Fas |
| Short name | CD95 (C-Fc), TNFRSF6, Recombinant Mouse Fas |
| Technique | E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Mouses, Mouse |
| Alternative name | CD95 (C-fragment c), TNFRSF6, member 6), recombinant Mouse Fas (TNF receptor superfamily |
| Alternative technique | rec |
| Identity | 11920 |
| Gene | FAS |
| Long gene name | Fas cell surface death receptor |
| Synonyms gene | FAS1 APT1 TNFRSF6 |
| Synonyms gene name | member 6 Fas (TNF receptor superfamily, member 6) , tumor necrosis factor receptor superfamily |
| Synonyms | CD95 APO-1 |
| Synonyms name | TNF receptor superfamily member 6 |
| Locus | 10q23, 31 |
| Discovery year | 1992-06-25 |
| GenBank acession | M67454 |
| Entrez gene record | 355 |
| Pubmed identfication | 1385299 1385309 |
| Classification | CD molecules Tumor necrosis factor receptor superfamily Death inducing signaling complex |
| Havana BLAST/BLAT | OTTHUMG00000018701 |
| Locus Specific Databases | Autoimmune Lymphoproliferative Syndrome Database (ALPSbase): Database of mutations causing human ALPS LOVD at NCBI LRG_134 |