Name : Recombinant Mouse Fc Receptor-like Protein 1, FCRL1, FcRH1 (C-6His)
Supplier : NOVO
Price :303
SKU : GEN8719082218
| Reacts with | Mouse |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Mouse Fc receptor-like protein 1 is produced by our expression system and the target gene encoding Ala17-Ser219 is expressed with a 6His tag at the C-terminus |
| Molecular Weight | 22, 5 kD |
| UniProt number | Q8R4Y0 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | AGISDVSLKTRPPGGWVMEGDKLVLICSVDRVTGNITYFWYRGALGFQLETKTQPSLTAEFEISDMKQSDADQYYCAANDGHDPIASELVSIHVRVPVSRPVLTFGDSGTQAVLGDLVELHCKALRGSPPIFYQFYHESIILGNSSAPSGGGASFNFSLTAEHSGNFSCEASNGQGAQRSEVVALNLTGLSLVPTENGISHLSHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Test | A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or  |
| Latin name | Mus musculus |
| Group | recombinants |
| Gene target | FCRL1, FcRH1 (C-6His), Fc Receptor-like Protein 1 |
| Short name | FCRL1, FcRH1 (C-6His), Recombinant Mouse Fc Receptor-like Protein 1 |
| Technique | E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Mouses, Mouse |
| Alternative name | FcRH1 (C-6His), fragment c receptor-like 1, recombinant Mouse fragment c Receptor-like Protein 1 |
| Alternative technique | rec |
| Alternative to gene target | FCRL1 and IDBG-103709 and ENSG00000163534 and 115350, FCRL1 and IDBG-631097 and ENSBTAG00000005891 and 517846, Fcrl1 and IDBG-157118 and ENSMUSG00000059994 and 229499, Plasma membranes, protein binding, this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0016021 and integral component of membrane and cellular component, this GO :0005515: protein binding, this GO :0005515: protein binding, Fc receptor-like 1 |
| Identity | 18509 |
| Gene | FCRL1 |
| Long gene name | Fc receptor like 1 |
| Synonyms gene name | Fc receptor-like 1 |
| Synonyms | FCRH1 IRTA5 IFGP1 CD307a |
| Locus | 1q23, 1 |
| Discovery year | 2005-03-22 |
| GenBank acession | BC033690 |
| Entrez gene record | 115350 |
| Pubmed identfication | 11493702 11929751 |
| RefSeq identity | NM_052938 |
| Classification | CD molecules Immunoglobulin like domain containing |
| Havana BLAST/BLAT | OTTHUMG00000019398 |