Name : Recombinant Mouse Fc γ RIIIA, FCGR3, CD16 (C-6His)
Supplier : NOVO
Price :146
SKU : GEN4386713434
| Reacts with | Mouse |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Mouse Low affinity IgG Fc receptor III is produced by our Mammalian expression system and the target gene encoding Ala31-Thr215 is expressed with a 6His tag at the C-terminus |
| Molecular Weight | 22 kD |
| UniProt number | P08508 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | pH7, 2 um filtered solution of phosphate buffered saline, 5, Lyophilized from a 0 |
| Storage recommendations | -20°, -20°, Aliquots of reconstituted samples are stable at <, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 4 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH3O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to_x005F_x0008__x005F_x0006__x005F_x0008__x005F_x0006__x005F_x0008__x005F_x0006__x005F_x0008_퀒ᵒₕ, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | ALPKAVVKLDPPWIQVLKEDMVTLMCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQRVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYKSNFSIPKANHSHSGDYYCKGSLGSTQHQSKPVTITVQDPATTSSISLVWYHTHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Test | A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or  |
| Latin name | Mus musculus |
| Group | recombinants |
| Gene target | CD16 (C-6His), FCGR3, RIIIA, Fc &gamma |
| Short name | CD16 (C-6His), FCGR3, RIIIA, Recombinant Mouse Fc &gamma |
| Technique | E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Mouses |
| Alternative name | CD16 (C-6His), FCGR3, RIIIA, recombinant Mouse fragment c &gamma |
| Alternative technique | rec |
| Identity | 3620 |
| Gene | FCGR3B |
| Long gene name | Fc fragment of IgG receptor IIIb |
| Synonyms gene | FCGR3 FCG3 |
| Synonyms gene name | Fc fragment of IgG, low affinity IIIb, low affinity IIIb, receptor (CD16b) , receptor for (CD16) Fc fragment of IgG |
| Synonyms | CD16 CD16b |
| Synonyms name | Fc gamma receptor IIIb |
| Locus | 1q23, 3 |
| Discovery year | 1991-08-21 |
| GenBank acession | J04162 |
| Entrez gene record | 2215 |
| Pubmed identfication | 2139735 |
| RefSeq identity | NM_000570 |
| Classification | CD molecules Immunoglobulin like domain containing |
| Havana BLAST/BLAT | OTTHUMG00000074099 |