Name : Recombinant Mouse Fms-LikeTyrosine Kinase 3 Ligand, FLT3LG (C-6His)
Supplier : NOVO
Price :2283
SKU : GEN2569564026
| Reacts with | Mouse |
| Source | proteins, Recombinants or rec |
| Description | Receptor agonists are often tested for drug development, FAS ligand and other ligands are binding to the receptor for signaling pathways for example in apoptosis or JNK signaling |
| Molecular Weight | 19, 4 kD |
| UniProt number | P49772 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | pH 7, 2 um filtered solution of phosphate buffered saline, 4 , Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | GTPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNTEIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKACQNFSRCLEVQCQPDSSTLLPPRSPIALEATELPEPRPRVDHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Test | A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or  |
| Latin name | Mus musculus |
| Group | recombinants |
| Gene target | FLT3LG (C-6His), Fms-LikeTyrosine Kinase 3 Ligand |
| Short name | FLT3LG (C-6His), Recombinant Mouse Fms-LikeTyrosine Kinase 3 Ligand |
| Technique | E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Mouses, Mouse |
| Alternative name | fms-related tyrosine phosphorylation catalyst 3 ligand (C-6His), recombinant Mouse Fms-LikeTyrosine phosphorylation catalyst 3 Ligand |
| Alternative technique | rec |
| Alternative to gene target | Extracellular, FL and FLT3L, FLT3LG and IDBG-62803 and ENSG00000090554 and 2323, FLT3LG and IDBG-640541 and ENSBTAG00000038045 and 282233, Flt3l and IDBG-488510 and ENSMUSG00000089989 and 14256, protein homodimerization activity, this GO :0001934 and positive regulation of protein phosphorylation and biological process this GO :0005102 and receptor binding and molecular function this GO :0005125 and cytokine activity and molecular function this GO :0005615 and extracellular space and cellular component this GO :0007165 and signal transduction and biological process this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0009986 and cell surface and cellular component this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0030098 and lymphocyte differentiation and biological process this GO :0030971 and receptor tyrosine kinase binding and molecular function this GO :0031233 and intrinsic to external side of plasma membrane and cellular component this GO :0032825 and positive regulation of natural killer cell differentiation and biological process this GO :0035162 and embryonic hemopoiesis and biological process this GO :0042803 and protein homodimerization activity and molecular function, this GO :0005102: receptor binding, this GO :0005102: receptor binding and also this GO :0005125: cytokine activity and also this GO :0030971: receptor tyrosine kinase binding and also this GO :0042803: protein homodimerization activity, this GO :0005125: cytokine activity, this GO :0030971: receptor tyrosine kinase binding, this GO :0042803: protein homodimerization activity, fms-related tyrosine kinase 3 ligand |
| Identity | 3766 |
| Gene | FLT3LG |
| Long gene name | fms related tyrosine kinase 3 ligand |
| Synonyms gene name | fms-related tyrosine kinase 3 ligand |
| Locus | 19q13, 33 |
| Discovery year | 1994-07-21 |
| GenBank acession | U04806 |
| Entrez gene record | 2323 |
| Pubmed identfication | 8145851 7824267 |
| Classification | Endogenous ligands |
| Havana BLAST/BLAT | OTTHUMG00000186490 |