Name : Recombinant Mouse Folate Receptor Alpha, FOLR1 (C-6His)
Supplier : NOVO
Price :126
SKU : GEN4740667991
| Reacts with | Mouse |
| Source | proteins, Recombinants or rec |
| Description | FOLR1 (C-6His) is a &alpha, - or alpha protein sometimes glycoprotein present in blood, The Recombinant Mouse Folate Receptor Alpha |
| Molecular Weight | 25, 3 kD |
| UniProt number | P35846 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | TRARTELLNVCMDAKHHKEKPGPEDNLHDQCSPWKTNSCCSTNTSQEAHKDISYLYRFNWNHCGTMTSECKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERILDVPLCKEDCQQWWEDCQSSFTCKSNWHKGWNWSSGHNECPVGASCHPFTFYFPTSAALCEEIWSHSYKLSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAEAMSVDHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Test | A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or  |
| Latin name | Mus musculus |
| Group | recombinants |
| Gene target | FOLR1 (C-6His), Folate Receptor Alpha |
| Short name | FOLR1 (C-6His), Recombinant Mouse Folate Receptor Alpha |
| Technique | E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Mouses, Mouse |
| Alternative name | folate receptor 1 (adult) (C-6His), recombinant Mouse Folate Receptor a |
| Alternative technique | rec |
| Alternative to gene target | FBP and FOLR, FOLR1 and IDBG-63244 and ENSG00000110195 and 2348, Folr1 and IDBG-202269 and ENSMUSG00000001827 and 14275, Plasma membranes, folic acid transporter activity, this GO :0004872 and receptor activity and molecular function this GO :0005542 and folic acid binding and molecular function this GO :0005768 and endosome and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0005903 and brush border and cellular component this GO :0006898 and receptor-mediated endocytosis and biological process this GO :0008219 and cell death and biological process this GO :0008517 and folic acid transporter activity and molecular function this GO :0015884 and folic acid transport and biological process this GO :0016020 and membrane and cellular component this GO :0016324 and apical plasma membrane and cellular component this GO :0030136 and clathrin-coated vesicle and cellular component this GO :0031362 and anchored component of external side of plasma membrane and cellular component this GO :0031526 and brush border membrane and cellular component this GO :0046655 and folic acid metabolic process and biological process this GO :0046658 and anchored component of plasma membrane and cellular component this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0004872: receptor activity, this GO :0004872: receptor activity and also this GO :0005542: folic acid binding and also this GO :0008517: folic acid transporter activity, this GO :0005542: folic acid binding, this GO :0008517: folic acid transporter activity, folate receptor 1 (adult) |
| Identity | 3791 |
| Gene | FOLR1 |
| Long gene name | folate receptor 1 |
| Synonyms gene | FOLR |
| Synonyms gene name | folate receptor 1 (adult) |
| Synonyms name | folate receptor alpha |
| Locus | 11q13, 4 |
| Discovery year | 1991-08-08 |
| GenBank acession | J05013 |
| Entrez gene record | 2348 |
| Pubmed identfication | 1717147 |
| RefSeq identity | NM_016725 |
| Havana BLAST/BLAT | OTTHUMG00000167876 |