Name : Recombinant Mouse GM-CSF, CSF2 (C-6His)
Supplier : NOVO
Price :2486
SKU : GEN2366560520
| Reacts with | Mouse |
| Source | proteins, Recombinants or rec |
| Description | Recombinant MouseGM-CSF is produced by our Mammalian expression system and the target gene encoding Ala18-Lys141 is expressed with a 6His tag at the C-terminus |
| Molecular Weight | 1 kD, 15 |
| UniProt number | P01587 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | pH7, 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQKVDHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Gene | CSF2 |
| Test | A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or  |
| Latin name | Mus musculus |
| Group | recombinants |
| Gene target | CSF2 (C-6His), GM-CSF |
| Short name | CSF2 (C-6His), Recombinant Mouse GM-CSF |
| Technique | E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Mouses, Mouse |
| Alternative name | colony stimulating factor 2 (granulocyte-macrophage) (C-6His), recombinant Mouse GM-CSF |
| Alternative technique | rec |
| Alternative to gene target | CSF2 and IDBG-41275 and ENSG00000164400 and 1437, CSF2 and IDBG-644701 and ENSBTAG00000001570 and 281095, Csf2 and IDBG-172875 and ENSMUSG00000018916 and 12981, Extracellular, GMCSF, growth factor activity, this GO :0001892 and embryonic placenta development and biological process this GO :0005125 and cytokine activity and molecular function this GO :0005129 and granulocyte macrophage colony-stimulating factor receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006955 and immune response and biological process this GO :0008083 and growth factor activity and molecular function this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0010468 and regulation of gene expression and biological process this GO :0010628 and positive regulation of gene expression and biological process this GO :0010744 and positive regulation of macrophage derived foam cell differentiation and biological process this GO :0032747 and positive regulation of interleukin-23 production and biological process this GO :0042045 and epithelial fluid transport and biological process this GO :0042116 and macrophage activation and biological process this GO :0042127 and regulation of cell proliferation and biological process this GO :0042523 and positive regulation of tyrosine phosphorylation of Stat5 protein and biological process this GO :0043011 and myeloid dendritic cell differentiation and biological process this GO :0045740 and positive regulation of DNA replication and biological process this GO :0045918 and negative regulation of cytolysis and biological process this GO :0071222 and cellular response to lipopolysaccharide and biological process this GO :0071803 and positive regulation of podosome assembly and biological process this GO :0097028 and dendritic cell differentiation and biological process this GO :2001240 and negative regulation of extrinsic apoptotic signaling pathway in absence of ligand and biological process, this GO :0005125: cytokine activity, this GO :0005125: cytokine activity and also this GO :0005129: granulocyte macrophage colony-stimulating factor receptor binding and also this GO :0005515: protein binding and also this GO :0008083: growth factor activity, this GO :0005129: granulocyte macrophage colony-stimulating factor receptor binding, this GO :0005515: protein binding, this GO :0008083: growth factor activity, colony stimulating factor 2 (granulocyte-macrophage) |
| Identity | 2434 |
| Long gene name | colony stimulating factor 2 |
| Synonyms gene name | colony stimulating factor 2 (granulocyte-macrophage) |
| Synonyms | GM-CSF GMCSF |
| Synonyms name | sargramostim molgramostin granulocyte-macrophage colony stimulating factor |
| Locus | 5q31, 1 |
| Discovery year | 2001-06-22 |
| GenBank acession | M11734 |
| Entrez gene record | 1437 |
| Pubmed identfication | 3898082 2999978 |
| RefSeq identity | NM_000758 |
| Havana BLAST/BLAT | OTTHUMG00000059637 |