Name : Recombinant Mouse Granulocyte Colony-Stimulating Factor, G-CSF, CSF1
Supplier : NOVO
Price :496
SKU : GEN7384611564
| Reacts with | Mouse |
| Source | proteins, Recombinants or rec |
| Description | Colonies can be formed by stimulating factors or recombinant GM-CSF and CSFs activity expressed in Units compared to a standard |
| Molecular Weight | 18, 8 kD |
| UniProt number | P09920 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | VPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Gene | CSF3 |
| Test | A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or  |
| Latin name | Mus musculus |
| Group | recombinants |
| Gene target | CSF1, G-CSF, Granulocyte Colony-Stimulating Factor |
| Short name | CSF1, G-CSF, Recombinant Mouse Granulocyte Colony-Stimulating Factor |
| Technique | E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Mouses, Mouse |
| Alternative name | G-CSF, colony stimulating factor 1 (macrophage), recombinant Mouse Granulocyte Colony-Stimulating Factor |
| Alternative technique | rec |
| Alternative to gene target | CSF-1 and MCSF, CSF1 and IDBG-100920 and ENSG00000184371 and 1435, CSF1 and IDBG-635251 and ENSBTAG00000000283 and 281094, Csf1 and IDBG-185535 and ENSMUSG00000014599 and 12977, Extracellular, protein homodimerization activity, this GO :0001503 and ossification and biological process this GO :0001954 and positive regulation of cell-matrix adhesion and biological process this GO :0002158 and osteoclast proliferation and biological process this GO :0003006 and developmental process involved in reproduction and biological process this GO :0005125 and cytokine activity and molecular function this GO :0005157 and macrophage colony-stimulating factor receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006954 and inflammatory response and biological process this GO :0008083 and growth factor activity and molecular function this GO :0008283 and cell proliferation and biological process this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0010628 and positive regulation of gene expression and biological process this GO :0010743 and regulation of macrophage derived foam cell differentiation and biological process this GO :0010744 and positive regulation of macrophage derived foam cell differentiation and biological process this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0030097 and hemopoiesis and biological process this GO :0030154 and cell differentiation and biological process this GO :0030225 and macrophage differentiation and biological process this GO :0030278 and regulation of ossification and biological process this GO :0030316 and osteoclast differentiation and biological process this GO :0030335 and positive regulation of cell migration and biological process this GO :0032270 and positive regulation of cellular protein metabolic process and biological process this GO :0032946 and positive regulation of mononuclear cell proliferation and biological process this GO :0040018 and positive regulation of multicellular organism growth and biological process this GO :0042117 and monocyte activation and biological process this GO :0042476 and odontogenesis and biological process this GO :0042488 and positive regulation of odontogenesis of dentin-containing tooth and biological process this GO :0042803 and protein homodimerization activity and molecular function this GO :0043235 and receptor complex and cellular component this GO :0045087 and innate immune response and biological process this GO :0045651 and positive regulation of macrophage differentiation and biological process this GO :0045657 and positive regulation of monocyte differentiation and biological process this GO :0045672 and positive regulation of osteoclast differentiation and biological process this GO :0045860 and positive regulation of protein kinase activity and biological process this GO :0046579 and positive regulation of Ras protein signal transduction and biological process this GO :0048471 and perinuclear region of cytoplasm and cellular component this GO :0048873 and homeostasis of number of cells within a tissue and biological process this GO :0060444 and branching involved in mammary gland duct morphogenesis and biological process this GO :0060611 and mammary gland fat development and biological process this GO :0060763 and mammary duct terminal end bud growth and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0005125: cytokine activity, this GO :0005125: cytokine activity and also this GO :0005157: macrophage colony-stimulating factor receptor binding and also this GO :0005515: protein binding and also this GO :0008083: growth factor activity and also this GO :0042803: protein homodimerization activity, this GO :0005157: macrophage colony-stimulating factor receptor binding, this GO :0005515: protein binding, this GO :0008083: growth factor activity, this GO :0042803: protein homodimerization activity, colony stimulating factor 1 (macrophage) |
| Identity | 2438 |
| Long gene name | colony stimulating factor 3 |
| Synonyms gene | GCSF G-CSF C17orf33 |
| Synonyms gene name | chromosome 17 open reading frame 33 colony stimulating factor 3 (granulocyte) |
| Synonyms | MGC45931 |
| Synonyms name | granulocyte colony stimulating factor pluripoietin filgrastim lenograstim |
| Locus | 17q21, 1 |
| Discovery year | 2001-06-22 |
| Entrez gene record | 1440 |
| Pubmed identfication | 3499671 3501046 |
| RefSeq identity | NM_172220 |
| Classification | Endogenous ligands |
| Havana BLAST/BLAT | OTTHUMG00000133247 |