Name : Recombinant Mouse Inducible T-cell Costimulator, ICOS(C-6His)
Supplier : NOVO
Price :1014
SKU : GEN7030764048
| Reacts with | Mouse |
| Source | proteins, Recombinants or rec |
| Description | cell lines and tissues in culture till half confluency, For cells |
| Molecular Weight | 14, 7 kD |
| UniProt number | Q9WVS0 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | EINGSADHRMFSFHNGGVQISCKYPETVQQLKMRLFREREVLCELTKTKGSGNAVSIKNPMLCLYHLSNNSVSFFLNNPDSSQGSYYFCSLSIFDPPPFQERNLSGGYLHIYESQLCCQLKLHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Test | A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or  |
| Latin name | Mus musculus |
| Group | recombinants |
| Gene target | ICOS(C-6His), T Costimulator |
| Short name | ICOS(C-6His), Recombinant Mouse T- Costimulator |
| Technique | E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Mouses, Mouse |
| Alternative name | inducible T-cell co-stimulator(C-6His), recombinant Mouse Inducible T-cellular Costimulator |
| Alternative technique | rec |
| Alternative to gene target | Extracellular, ICOS and IDBG-643378 and ENSBTAG00000021596 and 507026, ICOS and IDBG-79246 and ENSG00000163600 and 29851, Icos and IDBG-159737 and ENSMUSG00000026009 and 54167, protein binding, this GO :0002517 and T cell tolerance induction and biological process this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006955 and immune response and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0016337 and single organismal cell-cell adhesion and biological process this GO :0031295 and T cell costimulation and biological process, this GO :0005515: protein binding, this GO :0005515: protein binding, inducible T-cell co-stimulator |
| Identity | 5351 |
| Gene | ICOS |
| Long gene name | inducible T-cell costimulator |
| Synonyms | AILIM CD278 |
| Synonyms name | activation-inducible lymphocyte immunomediatory molecule |
| Locus | 2q33, 2 |
| Discovery year | 2000-02-29 |
| GenBank acession | AB023135 |
| Entrez gene record | 29851 |
| Pubmed identfication | 9930702 10617205 |
| RefSeq identity | NM_012092 |
| Classification | CD molecules |
| Havana BLAST/BLAT | OTTHUMG00000132880 |
| Locus Specific Databases | ICOSbase: Mutation registry for ICOS deficiency LRG_65 |