Name : Recombinant Mouse LILRB4, CD85k, ILT3 (C-6His)
Supplier : NOVO
Price :1877
SKU : GEN6312595197
| Reacts with | Mouse |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Mouse Leukocyte Immunoglobulin-like Receptor Subfamily B Member 4 is produced by our Mammalian expression system and the target gene encoding Gly24-Lys238 is expressed with a 6His tag at the C-terminus |
| Molecular Weight | 24, 9 kD |
| UniProt number | Q64281 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | GHLPKPIIWAEPGSVIAAYTSVITWCQGSWEAQYYHLYKEKSVNPWDTQVPLETRNKAKFNIPSMTTSYAGIYKCYYESAAGFSEHSDAMELVMTGAYENPSLSVYPSSNVTSGVSISFSCSSSIVFGRFILIQEGKHGLSWTLDSQHQANQPSYATFVLDAVTPNHNGTFRCYGYFRNEPQVWSKPSNSLDLMISETKDQSSTPTEDGLETYQKHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Test | A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or  |
| Latin name | Mus musculus |
| Group | recombinants |
| Gene target | CD85k, ILT3 (C-6His), LILRB4 |
| Short name | CD85k, ILT3 (C-6His), Recombinant Mouse LILRB4 |
| Technique | E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Mouses, Mouse |
| Alternative name | CD85k, ILT3 (C-6His), member 4, subfamily B (including TM and ITIM domains), recombinant Mouse leukocyte immunoglobulin-like receptor |
| Alternative technique | rec |
| Alternative to gene target | CD85K and ILT-3 and ILT3 and LIR-5 and LIR5, LILRB4 and IDBG-68893 and ENSG00000186818 and 11006, Plasma membranes, member 4, protein binding, subfamily B (with TM and ITIM domains), this GO :0002376 and immune system process and biological process this GO :0003823 and antigen binding and molecular function this GO :0004872 and receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0007165 and signal transduction and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0045671 and negative regulation of osteoclast differentiation and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0003823: antigen binding, this GO :0003823: antigen binding and also this GO :0004872: receptor activity and also this GO :0005515: protein binding, this GO :0004872: receptor activity, this GO :0005515: protein binding, leukocyte immunoglobulin-like receptor |
| Identity | 6608 |
| Gene | LILRB4 |
| Long gene name | leukocyte immunoglobulin like receptor B4 |
| Synonyms gene name | leukocyte immunoglobulin-like receptor, member 4 , subfamily B (with TM and ITIM domains) |
| Synonyms | LIR-5 ILT3 HM18 LIR5 CD85k |
| Synonyms name | leucocyte Ig-like receptor B4 |
| Locus | 19q13, 42 |
| Discovery year | 2000-01-11 |
| GenBank acession | U82979 |
| Entrez gene record | 11006 |
| Pubmed identfication | 9151699 9079806 |
| Classification | Inhibitory leukocyte immunoglobulin like receptors CD molecules |
| Havana BLAST/BLAT | OTTHUMG00000065879 |