Name : Recombinant Mouse Lymphotoxin β Receptor, LTBR, TNFRSF3, TNFRrp (C-Fc)
Supplier : NOVO
Price :2283
SKU : GEN3929896131
| Reacts with | Mouse |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Mouse Lymphotoxin beta Receptor is produced by our Mammalian expression system and the target gene encoding Ser28-Pro218 is expressed with a Fc tag at the C-terminus |
| Molecular Weight | 48, 7 kD |
| UniProt number | P50284 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | SQPQLVPPYRIENQTCWDQDKEYYEPMHDVCCSRCPPGEFVFAVCSRSQDTVCKTCPHNSYNEHWNHLSTCQLCRPCDIVLGFEEVAPCTSDRKAECRCQPGMSCVYLDNECVHCEEERLVLCQPGTEAEVTDEIMDTDVNCVPCKPGHFQNTSSPRARCQPHTRCEIQGLVEAAPGTSYSDTICKNPPEPVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Test | A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or  |
| Latin name | Mus musculus |
| Group | recombinants |
| Gene target | LTBR, Receptor, TNFRSF3, TNFRrp (C-Fc), Lymphotoxin &beta |
| Short name | LTBR, Receptor, TNFRSF3, TNFRrp (C-Fc), Recombinant Mouse Lymphotoxin &beta |
| Technique | E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Mouses |
| Alternative name | Receptor, TNFRSF3, TNFRrp (C-fragment c), lymphotoxin b receptor (TNFR superfamily, member 3), recombinant Mouse Lymphotoxin &beta |
| Alternative technique | rec |
| Alternative to gene target | CD18 and D12S370 and LT-BETA-R and TNF-R-III and TNFCR and TNFR-RP and TNFR2-RP and TNFR3 and TNFRSF3, LTBR and IDBG-13973 and ENSG00000111321 and 102724071, LTBR and IDBG-640501 and ENSBTAG00000015312 and 504653, Ltbr and IDBG-189788 and ENSMUSG00000030339 and 17000, Plasma membranes, identical protein binding, member 3), this GO :0005515 and protein binding and molecular function this GO :0006915 and apoptotic process and biological process this GO :0007165 and signal transduction and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0016032 and viral process and biological process this GO :0031625 and ubiquitin protein ligase binding and molecular function this GO :0042802 and identical protein binding and molecular function this GO :0043123 and positive regulation of I-kappaB kinase/NF-kappaB signaling and biological process this GO :0045087 and innate immune response and biological process this GO :0046330 and positive regulation of JNK cascade and biological process this GO :0071260 and cellular response to mechanical stimulus and biological process this GO :2001238 and positive regulation of extrinsic apoptotic signaling pathway and biological process, this GO :0005515: protein binding, this GO :0005515: protein binding and also this GO :0031625: ubiquitin protein ligase binding and also this GO :0042802: identical protein binding, this GO :0031625: ubiquitin protein ligase binding, this GO :0042802: identical protein binding, 4055, lymphotoxin beta receptor (TNFR superfamily |
| Identity | 6718 |
| Gene | LTBR |
| Long gene name | lymphotoxin beta receptor |
| Synonyms gene | D12S370 |
| Synonyms | TNFCR TNFR-RP TNFR2-RP TNF-R-III TNFRSF3 |
| Synonyms name | TNFR superfamily, member 3 |
| Locus | 12p13 |
| Discovery year | 1996-03-12 |
| GenBank acession | L04270 |
| Entrez gene record | 4055 |
| Pubmed identfication | 8171323 8486360 |
| Classification | Tumor necrosis factor receptor superfamily |
| Havana BLAST/BLAT | OTTHUMG00000168356 |