Name : Recombinant Mouse Nephroblastoma Overexpressed Gene , NOV, CCN3, IGFBP-9 (C-6His)
Supplier : NOVO
Price :1328
SKU : GEN9447001788
| Reacts with | Mouse |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Mouse CCN3 is produced by our Mammalian expression system and the target gene encoding Ser26-Ile354 is expressed with a 6His tag at the C-terminus |
| Molecular Weight | 1 kD, 39 |
| UniProt number | Q64299 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | SLRCPSRCPPKCPSISPTCAPGVRSVLDGCSCCPVCARQRGESCSEMRPCDQSSGLYCDRSADPNNQTGICMVPEGDNCVFDGVIYRNGEKFEPNCQYFCTCRDGQIGCLPRCQLDVLLPGPDCPAPRKVAVPGECCEKWTCGSDEQGTQGTLGGLALPAYRPEATVGVEVSDSSINCIEQTTEWSACSKSCGMGVSTRVTNRNRQCEMVKQTRLCIVRPCEQEPEEVTDKKGKKCLRTKKSLKAIHLQFENCTSLYTYKPRFCGVCSDGRCCTPHNTKTIQVEFQCLPGEIIKKPVMVIGTCTCYSNCPQNNEAFLQDLELKTSRGEIVDHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Test | A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or  |
| Latin name | Mus musculus |
| Group | recombinants |
| Gene target | CCN3, IGFBP-9 (C-6His), Nephroblastoma Overexpressed Gene NOV |
| Short name | CCN3, IGFBP-9 (C-6His), Recombinant Mouse Nephroblastoma Overexpressed Gene NOV |
| Technique | E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Mouses, Mouse |
| Alternative name | CCN3, IGFBP-9 (C-6His), NOV, recombinant Mouse Nephroblastoma Overexpressed Gene |
| Alternative technique | rec |
| Identity | 7885 |
| Gene | NOV |
| Long gene name | nephroblastoma overexpressed |
| Synonyms gene name | nephroblastoma overexpressed gene |
| Synonyms | IGFBP9 CCN3 |
| Locus | 8q24, 12 |
| Discovery year | 1993-11-05 |
| GenBank acession | X96584 |
| Entrez gene record | 4856 |
| Pubmed identfication | 1334251 |
| RefSeq identity | NM_002514 |
| Classification | CYR61/CTGF/NOV matricellular proteins |
| Havana BLAST/BLAT | OTTHUMG00000164984 |