Name : Recombinant Mouse β-Nerve Growth Factor, β-NGF (Ser122-Gly241)
Supplier : NOVO
Price :1186
SKU : GEN3260822491
| Reacts with | Mouse |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Mouse beta-Nerve Growth Factor is produced by our E, coli expression system and the target gene encoding Ser122-Gly241 is expressed |
| Molecular Weight | 13, 5 kD |
| UniProt number | P01139 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 150 mM sodium chloride, 2 um filtered solution of 20 mM Tris, Lyophilized from a 0, pH8 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | SSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATRRG |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Test | A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or  |
| Latin name | Mus musculus |
| Group | recombinants |
| Gene target | &beta, &beta, -NGF (Ser122-Gly241), -Nerve Growth Factor |
| Short name | &beta, -NGF (Ser122-Gly241), -Nerve Growth Factor, Recombinant Mouse &beta |
| Technique | E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Mouses |
| Alternative name | &beta, -Nerve Growth Factor, -nerve growth factor (beta polypeptide) (Ser122-Gly241), recombinant Mouse &beta |
| Alternative technique | rec |
| Alternative to gene target | Beta-NGF and HSAN5 and NGFB, Extracellular, NGF and IDBG-101347 and ENSG00000134259 and 4803, NGF and IDBG-648895 and ENSBTAG00000007446 and 281350, Ngf and IDBG-180362 and ENSMUSG00000027859 and 18049, growth factor activity, this GO :0000186 and activation of MAPKK activity and biological process this GO :0005057 and receptor signaling protein activity and molecular function this GO :0005102 and receptor binding and molecular function this GO :0005163 and nerve growth factor receptor binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005768 and endosome and cellular component this GO :0005796 and this GO lgi lumen and cellular component this GO :0006954 and inflammatory response and biological process this GO :0007169 and transmembrane receptor protein tyrosine kinase signaling pathway and biological process this GO :0007202 and activation of phospholipase C activity and biological process this GO :0007264 and small GTPase mediated signal transduction and biological process this GO :0007265 and Ras protein signal transduction and biological process this GO :0007422 and peripheral nervous system development and biological process this GO :0007613 and memory and biological process this GO :0007623 and circadian rhythm and biological process this GO :0008083 and growth factor activity and molecular function this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0008344 and adult locomotory behavior and biological process this GO :0008625 and extrinsic apoptotic signaling pathway via death domain receptors and biological process this GO :0009314 and response to radiation and biological process this GO :0009612 and response to mechanical stimulus and biological process this GO :0010033 and response to organic substance and biological process this GO :0010193 and response to ozone and biological process this GO :0010628 and positive regulation of gene expression and biological process this GO :0010976 and positive regulation of neuron projection development and biological process this GO :0014042 and positive regulation of neuron maturation and biological process this GO :0014070 and response to organic cyclic compound and biological process this GO :0019233 and sensory perception of pain and biological process this GO :0030307 and positive regulation of cell growth and biological process this GO :0031175 and neuron projection development and biological process this GO :0031954 and positive regulation of protein autophosphorylation and biological process this GO :0032455 and nerve growth factor processing and biological process this GO :0032496 and response to lipopolysaccharide and biological process this GO :0035094 and response to nicotine and biological process this GO :0035556 and intracellular signal transduction and biological process this GO :0042493 and response to drug and biological process this GO :0043065 and positive regulation of apoptotic process and biological process this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0043281 and regulation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0043434 and response to peptide hormone and biological process this GO :0043524 and negative regulation of neuron apoptotic process and biological process this GO :0045664 and regulation of neuron differentiation and biological process this GO :0045666 and positive regulation of neuron differentiation and biological process this GO :0045773 and positive regulation of axon extension and biological process this GO :0045786 and negative regulation of cell cycle and biological process this GO :0046928 and regulation of neurotransmitter secretion and biological process this GO :0048011 and neurotrophin TRK receptor signaling pathway and biological process this GO :0048015 and phosphatidylinositol-mediated signaling and biological process this GO :0048812 and neuron projection morphogenesis and biological process this GO :0050770 and regulation of axonogenesis and biological process this GO :0050772 and positive regulation of axonogenesis and biological process this GO :0051091 and positive regulation of sequence-specific DNA binding transcription factor activity and biological process this GO :0051384 and response to glucocorticoid and biological process this GO :0051388 and positive regulation of nerve growth factor receptor signaling pathway and biological process this GO :0051402 and neuron apoptotic process and biological process this GO :0051602 and response to electrical stimulus and biological process this GO :0097190 and apoptotic signaling pathway and biological process this GO :0097192 and extrinsic apoptotic signaling pathway in absence of ligand and biological process this GO :2000648 and positive regulation of stem cell proliferation and biological process this GO :2000675 and negative regulation of type B pancreatic cell apoptotic process and biological process, this GO :0005057: receptor signaling protein activity, this GO :0005057: receptor signaling protein activity and also this GO :0005102: receptor binding and also this GO :0005163: nerve growth factor receptor binding and also this GO :0008083: growth factor activity, this GO :0005102: receptor binding, this GO :0005163: nerve growth factor receptor binding, this GO :0008083: growth factor activity, nerve growth factor (beta polypeptide) |