Name : Recombinant Mouse NGAL, Lipocalin-2, LCN2 (C-6His)
Supplier : NOVO
Price :1877
SKU : GEN2216631578
| Reacts with | Mouse |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Mouse NGAL is produced by our Mammalian expression system and the target gene encoding Gln21-Asn200 is expressed with a 6His tag at the C-terminus |
| Molecular Weight | 21, 9 kD |
| UniProt number | P11672 |
| State of the product | Liquid |
| Shipping conditions | Dry ice/ice packs |
| Formulation | 10% Glycerol, 150 mM sodium chloride, pH 5, 2 um filtered solution of 20 mM MES, 5, Supplied as a 0 |
| Storage recommendations | -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | QDSTQNLIPAPSLLTVPLQPDFRSDQFRGRWYVVGLAGNAVQKKTEGSFTMYSTIYELQENNSYNVTSILVRDQDQGCRYWIRTFVPSSRAGQFTLGNMHRYPQVQSYNVQVATTDYNQFAMVFFRKTSENKQYFKITLYGRTKELSPELKERFTRFAKSLGLKDDNIIFSVPTDQCIDNVDHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Test | A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or  |
| Latin name | Mus musculus |
| Group | recombinants |
| Gene target | LCN2 (C-6His), Lipocalin-2, NGAL |
| Short name | LCN2 (C-6His), Lipocalin-2, Recombinant Mouse NGAL |
| Technique | E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Mouses, Mouse |
| Alternative name | Lipocalin-2, lipocalin 2 (C-6His), recombinant Mouse NGAL |
| Alternative technique | rec |
| Alternative to gene target | 24p3 and MSFI and NGAL, BT, Extracellular, LCN2 and IDBG-87415 and ENSG00000148346 and 3934, Lcn2 and IDBG-160059 and ENSMUSG00000026822 and 16819, protein homodimerization activity, this GO :0002020 and protease binding and molecular function this GO :0005215 and transporter activity and molecular function this GO :0005506 and iron ion binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005829 and cytosol and cellular component this GO :0006810 and transport and biological process this GO :0006811 and ion transport and biological process this GO :0006979 and response to oxidative stress and biological process this GO :0009615 and response to virus and biological process this GO :0009617 and response to bacterium and biological process this GO :0009635 and response to herbicide and biological process this GO :0009636 and response to toxic substance and biological process this GO :0010628 and positive regulation of gene expression and biological process this GO :0015891 and siderophore transport and biological process this GO :0031346 and positive regulation of cell projection organization and biological process this GO :0031667 and response to nutrient levels and biological process this GO :0031669 and cellular response to nutrient levels and biological process this GO :0036094 and small molecule binding and molecular function this GO :0042493 and response to drug and biological process this GO :0042803 and protein homodimerization activity and molecular function this GO :0045087 and innate immune response and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0070207 and protein homotrimerization and biological process this GO :0070301 and cellular response to hydrogen peroxide and biological process this GO :0071222 and cellular response to lipopolysaccharide and biological process this GO :0071347 and cellular response to interleukin-1 and biological process this GO :0071356 and cellular response to tumor necrosis factor and biological process this GO :0097192 and extrinsic apoptotic signaling pathway in absence of ligand and biological process, this GO :0002020: protease binding, this GO :0002020: protease binding and also this GO :0005215: transporter activity and also this GO :0005506: iron ion binding and also this GO :0005515: protein binding and also this GO :0036094: small molecule binding and also this GO :0042803: protein homodimerization activity, this GO :0005215: transporter activity, this GO :0005506: iron ion binding, this GO :0005515: protein binding, this GO :0036094: small molecule binding, this GO :0042803: protein homodimerization activity, 61865 and IDBG-639105 and ENSBTAG00000014149 and 526639, lipocalin 2 |
| Identity | 6526 |
| Gene | LCN2 |
| Long gene name | lipocalin 2 |
| Synonyms gene name | lipocalin 2 (oncogene 24p3) |
| Synonyms | NGAL 24p3 |
| Synonyms name | oncogene 24p3 neutrophil gelatinase-associated lipocalin siderocalin |
| Locus | 9q34, 11 |
| Discovery year | 1994-04-29 |
| Entrez gene record | 3934 |
| Pubmed identfication | 7683678 |
| RefSeq identity | NM_005564 |
| Classification | Lipocalins |
| Havana BLAST/BLAT | OTTHUMG00000020734 |