Name : Recombinant Mouse Noggin, NOG (C-6His)
Supplier : NOVO
Price :141
SKU : GEN7113306306
| Reacts with | Mouse |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Mouse Noggin is produced by our Mammalian expression system and the target gene encoding Gln28-Cys232 is expressed with a 6His tag at the C-terminus |
| Molecular Weight | 23, 9 kD |
| UniProt number | P97466 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSCHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Test | A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or  |
| Latin name | Mus musculus |
| Group | recombinants |
| Gene target | NOG (C-6His), Noggin |
| Short name | NOG (C-6His), Recombinant Mouse Noggin |
| Technique | E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Mouses, Mouse |
| Alternative name | noggin (C-6His), recombinant Mouse Noggin |
| Alternative technique | rec |
| Alternative to gene target | Extracellular, NOG and IDBG-60160 and ENSG00000183691 and 9241, NOG and IDBG-647068 and ENSBTAG00000040282 and 538769, Nog and IDBG-208239 and ENSMUSG00000048616 and 18121, SYM1 and SYNS1, protein homodimerization activity, this GO :0000122 and negative regulation of transcription from RNA polymerase II promoter and biological process this GO :0001501 and skeletal system development and biological process this GO :0001649 and osteoblast differentiation and biological process this GO :0001655 and urogenital system development and biological process this GO :0001657 and ureteric bud development and biological process this GO :0001701 and in utero embryonic development and biological process this GO :0001706 and endoderm formation and biological process this GO :0001707 and mesoderm formation and biological process this GO :0001837 and epithelial to mesenchymal transition and biological process this GO :0001839 and neural plate morphogenesis and biological process this GO :0001843 and neural tube closure and biological process this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0007389 and pattern specification process and biological process this GO :0007399 and nervous system development and biological process this GO :0007411 and axon guidance and biological process this GO :0007417 and central nervous system development and biological process this GO :0007420 and brain development and biological process this GO :0008045 and motor neuron axon guidance and biological process this GO :0009953 and dorsal/ventral pattern formation and biological process this GO :0010629 and negative regulation of gene expression and biological process this GO :0019955 and cytokine binding and molecular function this GO :0021510 and spinal cord development and biological process this GO :0021533 and cell differentiation in hindbrain and biological process this GO :0021915 and neural tube development and biological process this GO :0021983 and pituitary gland development and biological process this GO :0030336 and negative regulation of cell migration and biological process this GO :0030509 and BMP signaling pathway and biological process this GO :0030510 and regulation of BMP signaling pathway and biological process this GO :0030514 and negative regulation of BMP signaling pathway and biological process this GO :0035019 and somatic stem cell maintenance and biological process this GO :0042060 and wound healing and biological process this GO :0042474 and middle ear morphogenesis and biological process this GO :0042733 and embryonic digit morphogenesis and biological process this GO :0042803 and protein homodimerization activity and molecular function this GO :0045596 and negative regulation of cell differentiation and biological process this GO :0045668 and negative regulation of osteoblast differentiation and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0048318 and axial mesoderm development and biological process this GO :0048570 and notochord morphogenesis and biological process this GO :0048646 and anatomical structure formation involved in morphogenesis and biological process this GO :0048706 and embryonic skeletal system development and biological process this GO :0048712 and negative regulation of astrocyte differentiation and biological process this GO :0048762 and mesenchymal cell differentiation and biological process this GO :0050679 and positive regulation of epithelial cell proliferation and biological process this GO :0051216 and cartilage development and biological process this GO :0060044 and negative regulation of cardiac muscle cell proliferation and biological process this GO :0060173 and limb development and biological process this GO :0060272 and embryonic skeletal joint morphogenesis and biological process this GO :0060302 and negative regulation of cytokine activity and biological process this GO :0060325 and face morphogenesis and biological process this GO :0060394 and negative regulation of pathway-restricted SMAD protein phosphorylation and biological process this GO :0060425 and lung morphogenesis and biological process this GO :0060513 and prostatic bud formation and biological process this GO :0060676 and ureteric bud formation and biological process this GO :0060825 and fibroblast growth factor receptor signaling pathway involved in neural plate anterior/posterior pattern formation and biological process this GO :0061037 and negative regulation of cartilage development and biological process this GO :0061053 and somite development and biological process this GO :0071773 and cellular response to BMP stimulus and biological process this GO :0090090 and negative regulation of canonical Wnt signaling pathway and biological process this GO :0090190 and positive regulation of branching involved in ureteric bud morphogenesis and biological process this GO :0090193 and positive regulation of glomerulus development and biological process this GO :2000313 and regulation of fibroblast growth factor receptor signaling pathway involved in neural plate anterior/posterior pattern formation and biological process this GO :2001234 and negative regulation of apoptotic signaling pathway and biological process, this GO :0005515: protein binding, this GO :0005515: protein binding and also this GO :0019955: cytokine binding and also this GO :0042803: protein homodimerization activity, this GO :0019955: cytokine binding, this GO :0042803: protein homodimerization activity, noggin |
| Identity | 7866 |
| Gene | NOG |
| Long gene name | noggin |
| Synonyms gene | SYNS1 SYM1 |
| Synonyms gene name | synostoses (multiple) syndrome 1 symphalangism 1 (proximal) |
| Locus | 17q22 |
| Discovery year | 1999-03-24 |
| GenBank acession | U31202 |
| Entrez gene record | 9241 |
| Pubmed identfication | 7666191 10080184 11545688 |
| RefSeq identity | NM_005450 |
| Havana BLAST/BLAT | OTTHUMG00000151770 |