Name : Recombinant Mouse Peptidyl-prolyl Cis-trans Isomerase A, Cyclophilin A, CYPA
Supplier : NOVO
Price :659
SKU : GEN3179265464
| Reacts with | Mouse |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Mouse Peptidyl-prolyl Cis-trans Isomerase A is produced by our E, coli expression system and the target gene encoding Met1-Leu164 is expressed |
| Molecular Weight | 18 kD |
| UniProt number | P17742 |
| State of the product | Liquid |
| Shipping conditions | Dry Ice/ice packs |
| Formulation | 10%glycerol, pH7, 2 um filtered solution of phosphate buffered saline, 4, Supplied as a 0 |
| Storage recommendations | -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | MVNPTVFFDITADDEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIPGFMCQGGDFTRHNGTGGRSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITISDCGQL |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Test | A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or  |
| Latin name | Mus musculus |
| Group | recombinants |
| Gene target | CYPA, Cyclophilin A, Peptidyl-prolyl Cis-trans Isomerase A |
| Short name | CYPA, Cyclophilin A, Recombinant Mouse Peptidyl-prolyl Cis-trans Isomerase A |
| Technique | E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Mouses, Mouse |
| Alternative name | CYPA, Cyclophilin A, recombinant Mouse Peptidyl-prolyl Cis-trans Isomerase A |
| Alternative technique | rec |
| Identity | 9253 |
| Gene | PPIA |
| Long gene name | peptidylprolyl isomerase A |
| Synonyms | CYPA |
| Synonyms name | cyclophilin A |
| Locus | 7p13 |
| Discovery year | 1991-12-06 |
| GenBank acession | X52851 |
| Entrez gene record | 5478 |
| Pubmed identfication | 1989998 2197089 |
| RefSeq identity | NM_021130 |
| Classification | Cyclophilin peptidylprolyl isomerases |
| Havana BLAST/BLAT | OTTHUMG00000023687 |