Name : Recombinant Mouse Prolactin Receptor, PRLR (C-6His)
Supplier : NOVO
Price :232
SKU : GEN5698549172
| Reacts with | Mouse |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Mouse Prolactin receptor is produced by our Mammalian expression system and the target gene encoding Gln20-Asp229 is expressed with a 6His tag at the C-terminus |
| Molecular Weight | 25, 6 kD |
| UniProt number | Q08501 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | QSPPGKPEIHKCRSPDKETFTCWWNPGSDGGLPTNYSLTYSKEGEKNTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNEMGSSTSDPLYVDVTYIVEPEPPRNLTLEVKQLKDKKTYLWVKWLPPTITDVKTGWFTMEYEIRLKSEEADEWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWGQEKSIEIPNDFTLKDVDHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Test | A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or  |
| Latin name | Mus musculus |
| Group | recombinants |
| Gene target | PRLR (C-6His), Prolactin Receptor |
| Short name | PRLR (C-6His), Recombinant Mouse Prolactin Receptor |
| Technique | E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Mouses, Mouse |
| Alternative name | prolactin receptor (C-6His), recombinant Mouse Prolactin Receptor |
| Alternative technique | rec |
| Alternative to gene target | Extracellular, HPRL and hPRLrI and MFAB, PRLR and IDBG-15793 and ENSG00000113494 and 5618, PRLR and IDBG-630451 and ENSBTAG00000025035 and 281422, Prlr and IDBG-129218 and ENSMUSG00000005268 and 19116, metal ion binding, this GO :0004896 and cytokine receptor activity and molecular function this GO :0004925 and prolactin receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006694 and steroid biosynthetic process and biological process this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0007171 and activation of transmembrane receptor protein tyrosine kinase activity and biological process this GO :0007259 and JAK-STAT cascade and biological process this GO :0007566 and embryo implantation and biological process this GO :0007595 and lactation and biological process this GO :0009986 and cell surface and cellular component this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0017046 and peptide hormone binding and molecular function this GO :0019221 and cytokine-mediated signaling pathway and biological process this GO :0030155 and regulation of cell adhesion and biological process this GO :0030856 and regulation of epithelial cell differentiation and biological process this GO :0031904 and endosome lumen and cellular component this GO :0038161 and prolactin signaling pathway and biological process this GO :0042110 and T cell activation and biological process this GO :0042803 and protein homodimerization activity and molecular function this GO :0042977 and activation of JAK2 kinase activity and biological process this GO :0042978 and ornithine decarboxylase activator activity and molecular function this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0046872 and metal ion binding and molecular function this GO :0060397 and JAK-STAT cascade involved in growth hormone signaling pathway and biological process this GO :0060644 and mammary gland epithelial cell differentiation and biological process this GO :0060736 and prostate gland growth and biological process this GO :0060749 and mammary gland alveolus development and biological process this GO :0061180 and mammary gland epithelium development and biological process, this GO :0004896: cytokine receptor activity, this GO :0004896: cytokine receptor activity and also this GO :0004925: prolactin receptor activity and also this GO :0005515: protein binding and also this GO :0017046: peptide hormone binding and also this GO :0042803: protein homodimerization activity and also this GO :0042978: ornithine decarboxylase activator activity and also this GO :0046872: metal ion binding, this GO :0004925: prolactin receptor activity, this GO :0005515: protein binding, this GO :0017046: peptide hormone binding, this GO :0042803: protein homodimerization activity, this GO :0042978: ornithine decarboxylase activator activity, this GO :0046872: metal ion binding, prolactin receptor |
| Identity | 9446 |
| Gene | PRLR |
| Long gene name | prolactin receptor |
| Locus | 5p13, 2 |
| Discovery year | 1989-12-01 |
| Entrez gene record | 5618 |
| Havana BLAST/BLAT | OTTHUMG00000090789 |