Name : Recombinant Mouse Sialic Acid Binding Ig-Like Lectin 3, Siglec-3, CD33 (C-6His)
Supplier : NOVO
Price :2283
SKU : GEN1348276173
| Reacts with | Mouse |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Mouse Sialic Acid Binding Ig-like Lectin 3 is produced by our Mammalian expression system and the target gene encoding Asp18-Glu240 is expressed with a 6His tag at the C-terminus |
| Molecular Weight | 25, 7 kD |
| UniProt number | Q63994 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | DLEFQLVAPESVTVEEGLCVHVPCSVFYPSIKLTLGPVTGSWLRKGVSLHEDSPVATSDPRQLVQKATQGRFQLLGDPQKHDCSLFIRDAQKNDTGMYFFRVVREPFVRYSYKKSQLSLHVTSLSRTPDIIIPGTLEAGYPSNLTCSVPWACEQGTPPTFSWMSTALTSLSSRTTDSSVLTFTPQPQDHGTKLTCLVTFSGAGVTVERTIQLNVTRKSGQMREVDHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Test | A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or  |
| Latin name | Mus musculus |
| Group | recombinants |
| Gene target | CD33 (C-6His), Siglec-3, Sialic Acid Binding Ig-Like Lectin 3 |
| Short name | CD33 (C-6His), Siglec-3, Recombinant Mouse Sialic Acid Binding Ig-Like Lectin 3 |
| Technique | E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Mouses, Mouse |
| Alternative name | CD33 molecule (C-6His), Siglec-3, recombinant Mouse Sialic Acid Binding Ig-Like Lectin 3 |
| Alternative technique | rec |
| Alternative to gene target | CD33 and IDBG-65737 and ENSG00000105383 and 945, Cell surfaces, p67 and SIGLEC-3 and SIGLEC3, protein binding, this GO :0004872 and receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0007155 and cell adhesion and biological process this GO :0007165 and signal transduction and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0004872: receptor activity, this GO :0004872: receptor activity and also this GO :0005515: protein binding, this GO :0005515: protein binding, CD33 molecule |
| Identity | 1659 |
| Gene | CD33 |
| Long gene name | CD33 molecule |
| Synonyms gene name | CD33 antigen (gp67) |
| Synonyms | SIGLEC3 SIGLEC-3 p67 FLJ00391 |
| Synonyms name | sialic acid binding Ig-like lectin 3 |
| Locus | 19q13, 41 |
| Discovery year | 1986-01-01 |
| GenBank acession | M23197 |
| Entrez gene record | 945 |
| Pubmed identfication | 3139766 9465907 |
| RefSeq identity | NM_001772 |
| Classification | CD molecules Sialic acid binding Ig like lectins V-set domain containing |
| Havana BLAST/BLAT | OTTHUMG00000182891 |