Name : Recombinant Mouse Signal-Regulatory Protein α-1, SIRPA, CD172a (C-6His)
Supplier : NOVO
Price :2283
SKU : GEN6080907417
| Reacts with | Mouse |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Mouse Signal-Regulatory Protein alpha 1 is produced by our Mammalian expression system and the target gene encoding Lys32-Asn372 is expressed with a 6His tag at the C-terminus |
| Molecular Weight | 35 kD |
| UniProt number | Q6P6I8 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | KELKVTQPEKSVSVAAGDSTVLNCTLTSLLPVGPIRWYRGVGPSRLLIYSFAGEYVPRIRNVSDTTKRNNMDFSIRISNVTPADAGIYYCVKFQKGSSEPDTEIQSGGGTEVYVLAKPSPPEVSGPADRGIPDQKVNFTCKSHGFSPRNITLKWFKDGQELHPLETTVNPSGKNVSYNISSTVRVVLNSMDVNSKVICEVAHITLDRSPLRGIANLSNFIRVSPTVKVTQQSPTSMNQVNLTCRAERFYPEDLQLIWLENGNVSRNDTPKNLTKNTDGTYNYTSLFLVNSSAHREDVVFTCQVKHDQQPAITRNHTVLGFAHSSDQGSMQTFPDNNATHNWNHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Test | A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or  |
| Latin name | Mus musculus |
| Group | recombinants |
| Gene target | CD172a (C-6His), SIRPA, -1, Signal-Regulatory Protein &alpha |
| Short name | CD172a (C-6His), SIRPA, -1, Recombinant Mouse Signal-Regulatory Protein &alpha |
| Technique | E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Mouses |
| Alternative name | CD172a (C-6His), signal-regulatory protein a, -1, recombinant Mouse Signal-Regulatory Protein &alpha |
| Alternative technique | rec |
| Alternative to gene target | Plasma membranes, SH3 domain binding, SIRPA and IDBG-40694 and ENSG00000198053 and 140885, this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0007155 and cell adhesion and biological process this GO :0007596 and blood coagulation and biological process this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0017124 and SH3 domain binding and molecular function this GO :0045087 and innate immune response and biological process this GO :0050900 and leukocyte migration and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0005515: protein binding, this GO :0005515: protein binding and also this GO :0017124: SH3 domain binding, this GO :0017124: SH3 domain binding, signal-regulatory protein alpha |
| Identity | 9662 |
| Gene | SIRPA |
| Long gene name | signal regulatory protein alpha |
| Synonyms gene | PTPNS1 |
| Synonyms gene name | non-receptor type substrate 1 signal-regulatory protein alpha , protein tyrosine phosphatase |
| Synonyms | SHPS1 SIRP MYD-1 BIT P84 SHPS-1 SIRPalpha CD172a SIRPalpha2 MFR SIRP-ALPHA-1 |
| Locus | 20p13 |
| Discovery year | 1999-03-19 |
| GenBank acession | D86043 |
| Entrez gene record | 140885 |
| Pubmed identfication | 9070220 9062191 16339511 |
| RefSeq identity | NM_080792 |
| Classification | C1-set domain containing CD molecules Signal regulatory proteins V-set domain containing |
| Havana BLAST/BLAT | OTTHUMG00000031682 |