Name : Recombinant Mouse SLAMF4, Natural killer cell receptor 2B4, CD244 (C-6His)
Supplier : NOVO
Price :2283
SKU : GEN8262529756
| Reacts with | Mouse |
| Source | proteins, Recombinants or rec |
| Description | 2 or 3 and , However, In this sense, The receptors are ligand binding factors of type 1, When such chemical-signals couple or bind to a receptor, a change in the electrical-activity of a cell, acetylcholine, am olfactory receptor is a protein-molecule that recognizes and responds to , an acetylcholine-receptor recognizes and responds to its endogenous-ligand, cell lines and tissues in culture till half confluency, chemokinesor cytokines e, e, sometimes in pharmacology, such as enzymes, the term is also used to include other proteins that are drug-targets, they cause some form of cellular/tissue-response, transporters and ion-channels, For cells, endogenous-chemical signals, g, g, protein-molecules , that receive chemical-signals from outside a cell |
| Molecular Weight | 23, 5 kD |
| UniProt number | Q07763 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | QDCPDSSEEVVGVSGKPVQLRPSNIQTKDVSVQWKKTEQGSHRKIEILNWYNDGPSWSNVSFSDIYGFDYGDFALSIKSAKLQDSGHYLLEITNTGGKVCNKNFQLLILDHVETPNLKAQWKPWTNGTCQLFLSCLVTKDDNVSYALYRGSTLISNQRNSTHWENQIDASSLHTYTCNVSNRASWANHTLNFTHGCQSVPSNHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Test | A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or  |
| Latin name | Mus musculus |
| Group | recombinants |
| Gene target | CD244 (C-6His), Natural killer receptor 2B4, SLAMF4 |
| Short name | CD244 (C-6His), Natural killer receptor 2B4, Recombinant Mouse SLAMF4 |
| Technique | E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Mouses, Mouse |
| Alternative name | CD244 molecule, Natural killer cellular receptor 2B4, natural killer cellular receptor 2B4 (C-6His), recombinant Mouse SLAMF4 |
| Alternative technique | rec |
| Alternative to gene target | CD244 and IDBG-104114 and ENSG00000122223 and 51744, CD244 and IDBG-630400 and ENSBTAG00000002951 and 513468, Cd244 and IDBG-204694 and ENSMUSG00000004709 and 18106, Cell surfaces, natural killer cell receptor 2B4, protein binding, this GO :0004872 and receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0007165 and signal transduction and biological process this GO :0007596 and blood coagulation and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0050900 and leukocyte migration and biological process, this GO :0004872: receptor activity, this GO :0004872: receptor activity and also this GO :0005515: protein binding, this GO :0005515: protein binding, CD244 molecule |
| Identity | 18171 |
| Gene | CD244 |
| Long gene name | CD244 molecule |
| Synonyms gene name | natural killer cell receptor 2B4 , natural killer cell receptor 2B4 CD244 natural killer cell receptor 2B4 CD244 molecule |
| Synonyms | 2B4 NAIL NKR2B4 Nmrk SLAMF4 |
| Locus | 1q23, 3 |
| Discovery year | 2003-10-23 |
| GenBank acession | AF105261 |
| Entrez gene record | 51744 |
| Pubmed identfication | 3772297 10458320 |
| RefSeq identity | NM_016382 |
| Classification | Immunoglobulin like domain containing CD molecules |
| Havana BLAST/BLAT | OTTHUMG00000028606 |