Name : Recombinant Mouse T cell Immunoglobulin and Mucin Domain-3, TIM-3, HAVCR2 (C-6His)
Supplier : NOVO
Price :1674
SKU : GEN1850916900
| Reacts with | Mouse |
| Source | proteins, Recombinants or rec |
| Description | cell lines and tissues in culture till half confluency, For cells |
| Molecular Weight | 19, 9 kD |
| UniProt number | Q8VIM0 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | LENAYVFEVGKNAYLPCSYTLSTPGALVPMCWGKGFCPWSQCTNELLRTDERNVTYQKSSRYQLKGDLNKGDVSLIIKNVTLDDHGTYCCRIQFPGLMNDKKLELKLDIKAAKVTPAQTAHGDSTTASPRTLTTERNGSETQTLVTLHNNNGTKISTWADEIKDSGETIRTAHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Test | A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or  |
| Latin name | Mus musculus |
| Group | recombinants |
| Gene target | HAVCR2 (C-6His), TIM-3, T Immunoglobulin Mucin Domain-3 |
| Short name | HAVCR2 (C-6His), TIM-3, Recombinant Mouse T Immunoglobulin Mucin Domain-3 |
| Technique | E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Mouses, Mouse |
| Alternative name | TIM-3, hepatitis A virus cellular receptor 2 (C-6His), recombinant Mouse T cellular Immunoglobulin and Mucin Domain-3 |
| Alternative technique | rec |
| Alternative to gene target | HAVCR2 and IDBG-55271 and ENSG00000135077 and 84868, Havcr2 and IDBG-165782 and ENSMUSG00000020399 and 171285, Plasma membranes, protein binding, this GO :0005515 and protein binding and molecular function this GO :0016021 and integral component of membrane and cellular component this GO :0045087 and innate immune response and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0005515: protein binding, this GO :0005515: protein binding, hepatitis A virus cellular receptor 2 |
| Identity | 18437 |
| Gene | HAVCR2 |
| Long gene name | hepatitis A virus cellular receptor 2 |
| Synonyms | Tim-3 TIM3 FLJ14428 TIMD3 CD366 |
| Synonyms name | T-cell immunoglobulin mucin family member 3 |
| Locus | 5q33, 3 |
| Discovery year | 2002-12-04 |
| GenBank acession | AK027334 |
| Entrez gene record | 84868 |
| Pubmed identfication | 11823861 |
| Classification | V-set domain containing |
| Havana BLAST/BLAT | OTTHUMG00000130249 |