Name : Recombinant Mouse TIGIT, VSIG9, VSTM3 (C-6His)
Supplier : NOVO
Price :1674
SKU : GEN1487377802
| Reacts with | Mouse |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Mouse TIGIT is produced by our Mammalian expression system and the target gene encoding Gly26-Phe135 is expressed with a 6His tag at the C-terminus |
| Molecular Weight | 13, 3 kD |
| UniProt number | P86176 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | GTIDTKRNISAEEGGSVILQCHFSSDTAEVTQVDWKQQDQLLAIYSVDLGWHVASVFSDRVVPGPSLGLTFQSLTMNDTGEYFCTYHTYPGGIYKGRIFLKVQESSVAQFGGGGSHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Test | A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or  |
| Latin name | Mus musculus |
| Group | recombinants |
| Gene target | VSIG9, VSTM3 (C-6His), TIGIT |
| Short name | VSIG9, VSTM3 (C-6His), Recombinant Mouse TIGIT |
| Technique | E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Mouses, Mouse |
| Alternative name | VSIG9, VSTM3 (C-6His), recombinant Mouse T cellular immunoreceptor including Ig and ITIM domains |
| Alternative technique | rec |
| Alternative to gene target | Cell surfaces, TIGIT and IDBG-50851 and ENSG00000181847 and 201633, TIGIT and IDBG-632631 and ENSBTAG00000011921 and 100140801, Tigit and IDBG-161101 and ENSMUSG00000071552 and 100043314, protein binding, this GO :0005102 and receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0009986 and cell surface and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0032695 and negative regulation of interleukin-12 production and biological process this GO :0032733 and positive regulation of interleukin-10 production and biological process this GO :0050868 and negative regulation of T cell activation and biological process, this GO :0005102: receptor binding, this GO :0005102: receptor binding and also this GO :0005515: protein binding, this GO :0005515: protein binding, T cell immunoreceptor with Ig and ITIM domains |
| Identity | 26838 |
| Gene | TIGIT |
| Long gene name | T-cell immunoreceptor with Ig and ITIM domains |
| Synonyms gene | VSIG9 VSTM3 |
| Synonyms gene name | V-set and immunoglobulin domain containing 9 V-set and transmembrane domain containing 3 T cell immunoreceptor with Ig and ITIM domains |
| Synonyms | FLJ39873 DKFZp667A205 |
| Locus | 3q13, 31 |
| Discovery year | 2006-02-07 |
| GenBank acession | AK097192 |
| Entrez gene record | 201633 |
| Pubmed identfication | 19011627 |
| RefSeq identity | NM_173799 |
| Classification | V-set domain containing |
| Havana BLAST/BLAT | OTTHUMG00000159331 |