| Reacts with | Mouse |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Mouse Transforming Growth Factor beta 1 is produced by our Mammalian expression system and the target gene encoding Ala279-Ser390 is expressed |
| Molecular Weight | 12, 8 kD |
| UniProt number | P04202 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 150 mM sodium chloride, 2 um filtered solution of 50 mM C2H5NO2, 5, Lyophilized from a 0, pH 2 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Test | A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or  |
| Latin name | Mus musculus |
| Group | recombinants |
| Gene target | TGF&beta, TGFB1, -1, 1, Transforming Growth Factor &beta |
| Short name | TGF&beta, TGFB1, -1, 1, Recombinant Mouse Transforming Growth Factor &beta |
| Technique | E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Mouses |
| Alternative name | TGF&beta, b 1, transforming growth factor, -1, 1, recombinant Mouse Transforming Growth Factor &beta |
| Alternative technique | rec |
| Alternative to gene target | CED and DPD1 and LAP and TGFB and TGFbeta, DNA-templated and biological process this GO :0045893 and positive regulation of transcription, DNA-templated and biological process this GO :0045930 and negative regulation of mitotic cell cycle and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0046732 and active induction of host immune response by virus and biological process this GO :0046982 and protein heterodimerization activity and molecular function this GO :0047485 and protein N-terminus binding and molecular function this GO :0048298 and positive regulation of isotype switching to IgA isotypes and biological process this GO :0048535 and lymph node development and biological process this GO :0048565 and digestive tract development and biological process this GO :0048642 and negative regulation of skeletal muscle tissue development and biological process this GO :0048839 and inner ear development and biological process this GO :0050679 and positive regulation of epithelial cell proliferation and biological process this GO :0050680 and negative regulation of epithelial cell proliferation and biological process this GO :0050714 and positive regulation of protein secretion and biological process this GO :0050765 and negative regulation of pha this GO cytosis and biological process this GO :0050777 and negative regulation of immune response and biological process this GO :0050868 and negative regulation of T cell activation and biological process this GO :0050921 and positive regulation of chemotaxis and biological process this GO :0051092 and positive regulation of NF-kappaB transcription factor activity and biological process this GO :0051098 and regulation of binding and biological process this GO :0051101 and regulation of DNA binding and biological process this GO :0051152 and positive regulation of smooth muscle cell differentiation and biological process this GO :0051280 and negative regulation of release of sequestered calcium ion into cytosol and biological process this GO :0051781 and positive regulation of cell division and biological process this GO :0051897 and positive regulation of protein kinase B signaling and biological process this GO :0060312 and regulation of blood vessel remodeling and biological process this GO :0060325 and face morphogenesis and biological process this GO :0060364 and frontal suture morphogenesis and biological process this GO :0060389 and pathway-restricted SMAD protein phosphorylation and biological process this GO :0060391 and positive regulation of SMAD protein import into nucleus and biological process this GO :0060744 and mammary gland branching involved in thelarche and biological process this GO :0060751 and branch elongation involved in mammary gland duct branching and biological process this GO :0060762 and regulation of branching involved in mammary gland duct morphogenesis and biological process this GO :0061035 and regulation of cartilage development and biological process this GO :0070306 and lens fiber cell differentiation and biological process this GO :0070723 and response to cholesterol and biological process this GO :0071158 and positive regulation of cell cycle arrest and biological process this GO :0071363 and cellular response to growth factor stimulus and biological process this GO :0071407 and cellular response to organic cyclic compound and biological process this GO :0071549 and cellular response to dexamethasone stimulus and biological process this GO :0071560 and cellular response to transforming growth factor beta stimulus and biological process this GO :0072562 and blood microparticle and cellular component this GO :0085029 and extracellular matrix assembly and biological process this GO :0090190 and positive regulation of branching involved in ureteric bud morphogenesis and biological process this GO :0097191 and extrinsic apoptotic signaling pathway and biological process this GO :1900126 and negative regulation of hyaluronan biosynthetic process and biological process this GO :1900182 and positive regulation of protein localization to nucleus and biological process this GO :1901203 and positive regulation of extracellular matrix assembly and biological process this GO :1901666 and positive regulation of NAD+ ADP-ribosyltransferase activity and biological process this GO :2000249 and regulation of actin cytoskeleton reorganization and biological process this GO :2000628 and regulation of miRNA metabolic process and biological process this GO :2000679 and positive regulation of transcription regulatory region DNA binding and biological process, TGFB1 and IDBG-52846 and ENSG00000105329 and 7040, TGFB1 and IDBG-638417 and ENSBTAG00000020457 and 282089, Tgfb1 and IDBG-158292 and ENSMUSG00000002603 and 21803, beta 1, incompatible interaction and biological process this GO :0009986 and cell surface and cellular component this GO :0010033 and response to organic substance and biological process this GO :0010575 and positive regulation vascular endothelial growth factor production and biological process this GO :0010628 and positive regulation of gene expression and biological process this GO :0010629 and negative regulation of gene expression and biological process this GO :0010716 and negative regulation of extracellular matrix disassembly and biological process this GO :0010718 and positive regulation of epithelial to mesenchymal transition and biological process this GO :0010742 and macrophage derived foam cell differentiation and biological process this GO :0010763 and positive regulation of fibroblast migration and biological process this GO :0010800 and positive regulation of peptidyl-threonine phosphorylation and biological process this GO :0010862 and positive regulation of pathway-restricted SMAD protein phosphorylation and biological process this GO :0010936 and negative regulation of macrophage cytokine production and biological process this GO :0014070 and response to organic cyclic compound and biological process this GO :0016049 and cell growth and biological process this GO :0016202 and regulation of striated muscle tissue development and biological process this GO :0017015 and regulation of transforming growth factor beta receptor signaling pathway and biological process this GO :0019048 and modulation by virus of host morphology or physiology and biological process this GO :0019049 and evasion or tolerance of host defenses by virus and biological process this GO :0019058 and viral life cycle and biological process this GO :0019899 and enzyme binding and molecular function this GO :0022408 and negative regulation of cell-cell adhesion and biological process this GO :0030141 and secretory granule and cellular component this GO :0030168 and platelet activation and biological process this GO :0030198 and extracellular matrix organization and biological process this GO :0030214 and hyaluronan catabolic process and biological process this GO :0030217 and T cell differentiation and biological process this GO :0030279 and negative regulation of ossification and biological process this GO :0030308 and negative regulation of cell growth and biological process this GO :0030334 and regulation of cell migration and biological process this GO :0030335 and positive regulation of cell migration and biological process this GO :0030424 and axon and cellular component this GO :0030501 and positive regulation of bone mineralization and biological process this GO :0030512 and negative regulation of transforming growth factor beta receptor signaling pathway and biological process this GO :0030879 and mammary gland development and biological process this GO :0031012 and extracellular matrix and cellular component this GO :0031065 and positive regulation of histone deacetylation and biological process this GO :0031093 and platelet alpha granule lumen and cellular component this GO :0031100 and organ regeneration and biological process this GO :0031334 and positive regulation of protein complex assembly and biological process this GO :0031536 and positive regulation of exit from mitosis and biological process this GO :0031663 and lipopolysaccharide-mediated signaling pathway and biological process this GO :0032270 and positive regulation of cellular protein metabolic process and biological process this GO :0032355 and response to estradiol and biological process this GO :0032570 and response to progesterone and biological process this GO :0032740 and positive regulation of interleukin-17 production and biological process this GO :0032801 and receptor catabolic process and biological process this GO :0032930 and positive regulation of superoxide anion generation and biological process this GO :0032943 and mononuclear cell proliferation and biological process this GO :0032967 and positive regulation of collagen biosynthetic process and biological process this GO :0033138 and positive regulation of peptidyl-serine phosphorylation and biological process this GO :0033280 and response to vitamin D and biological process this GO :0034616 and response to laminar fluid shear stress and biological process this GO :0035066 and positive regulation of histone acetylation and biological process this GO :0035307 and positive regulation of protein dephosphorylation and biological process this GO :0040007 and growth and biological process this GO :0042060 and wound healing and biological process this GO :0042110 and T cell activation and biological process this GO :0042127 and regulation of cell proliferation and biological process this GO :0042130 and negative regulation of T cell proliferation and biological process this GO :0042306 and regulation of protein import into nucleus and biological process this GO :0042307 and positive regulation of protein import into nucleus and biological process this GO :0042482 and positive regulation of odontogenesis and biological process this GO :0042493 and response to drug and biological process this GO :0042552 and myelination and biological process this GO :0042803 and protein homodimerization activity and molecular function this GO :0043011 and myeloid dendritic cell differentiation and biological process this GO :0043025 and neuronal cell body and cellular component this GO :0043029 and T cell homeostasis and biological process this GO :0043065 and positive regulation of apoptotic process and biological process this GO :0043406 and positive regulation of MAP kinase activity and biological process this GO :0043491 and protein kinase B signaling and biological process this GO :0043536 and positive regulation of blood vessel endothelial cell migration and biological process this GO :0043537 and negative regulation of blood vessel endothelial cell migration and biological process this GO :0043552 and positive regulation of phosphatidylinositol 3-kinase activity and biological process this GO :0043932 and ossification involved in bone remodeling and biological process this GO :0045066 and regulatory T cell differentiation and biological process this GO :0045087 and innate immune response and biological process this GO :0045216 and cell-cell junction organization and biological process this GO :0045599 and negative regulation of fat cell differentiation and biological process this GO :0045662 and negative regulation of myoblast differentiation and biological process this GO :0045786 and negative regulation of cell cycle and biological process this GO :0045892 and negative regulation of transcription, nuclei, protein N-terminus binding, this GO :0000060 and protein import into nucleus, this GO :0001948: glycoprotein binding, this GO :0001948: glycoprotein binding and also this GO :0003823: antigen binding and also this GO :0005114: type II transforming growth factor beta receptor binding and also this GO :0005125: cytokine activity and also this GO :0005515: protein binding and also this GO :0008083: growth factor activity and also this GO :0019899: enzyme binding and also this GO :0042803: protein homodimerization activity and also this GO :0046982: protein heterodimerization activity and also this GO :0047485: protein N-terminus binding, this GO :0003823: antigen binding, this GO :0005114: type II transforming growth factor beta receptor binding, this GO :0005125: cytokine activity, this GO :0005515: protein binding, this GO :0008083: growth factor activity, this GO :0019899: enzyme binding, this GO :0042803: protein homodimerization activity, this GO :0046982: protein heterodimerization activity, this GO :0047485: protein N-terminus binding, translocation and biological process this GO :0000122 and negative regulation of transcription from RNA polymerase II promoter and biological process this GO :0000165 and MAPK cascade and biological process this GO :0001657 and ureteric bud development and biological process this GO :0001666 and response to hypoxia and biological process this GO :0001763 and morphogenesis of a branching structure and biological process this GO :0001775 and cell activation and biological process this GO :0001837 and epithelial to mesenchymal transition and biological process this GO :0001933 and negative regulation of protein phosphorylation and biological process this GO :0001934 and positive regulation of protein phosphorylation and biological process this GO :0001948 and glycoprotein binding and molecular function this GO :0002028 and regulation of sodium ion transport and biological process this GO :0002062 and chondrocyte differentiation and biological process this GO :0002244 and hematopoietic progenitor cell differentiation and biological process this GO :0002248 and connective tissue replacement involved in inflammatory response wound healing and biological process this GO :0002460 and adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains and biological process this GO :0002513 and tolerance induction to self antigen and biological process this GO :0002576 and platelet degranulation and biological process this GO :0003823 and antigen binding and molecular function this GO :0005114 and type II transforming growth factor beta receptor binding and molecular function this GO :0005125 and cytokine activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005578 and proteinaceous extracellular matrix and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005796 and this GO lgi lumen and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005902 and microvillus and cellular component this GO :0006468 and protein phosphorylation and biological process this GO :0006611 and protein export from nucleus and biological process this GO :0006754 and ATP biosynthetic process and biological process this GO :0006796 and phosphate-containing compound metabolic process and biological process this GO :0006874 and cellular calcium ion homeostasis and biological process this GO :0006954 and inflammatory response and biological process this GO :0007050 and cell cycle arrest and biological process this GO :0007093 and mitotic cell cycle checkpoint and biological process this GO :0007173 and epidermal growth factor receptor signaling pathway and biological process this GO :0007179 and transforming growth factor beta receptor signaling pathway and biological process this GO :0007182 and common-partner SMAD protein phosphorylation and biological process this GO :0007183 and SMAD protein complex assembly and biological process this GO :0007184 and SMAD protein import into nucleus and biological process this GO :0007406 and negative regulation of neuroblast proliferation and biological process this GO :0007435 and salivary gland morphogenesis and biological process this GO :0007492 and endoderm development and biological process this GO :0007565 and female pregnancy and biological process this GO :0007568 and aging and biological process this GO :0007596 and blood coagulation and biological process this GO :0008083 and growth factor activity and molecular function this GO :0008156 and negative regulation of DNA replication and biological process this GO :0008283 and cell proliferation and biological process this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0008354 and germ cell migration and biological process this GO :0009314 and response to radiation and biological process this GO :0009611 and response to wounding and biological process this GO :0009749 and response to glucose and biological process this GO :0009817 and defense response to fungus, transforming growth factor |
| Identity | 11766 |
| Gene | TGFB1 |
| Long gene name | transforming growth factor beta 1 |
| Synonyms gene | TGFB DPD1 |
| Synonyms gene name | beta 1 , transforming growth factor |
| Synonyms | CED TGFbeta |
| Synonyms name | Camurati-Engelmann disease prepro-transforming growth factor beta-1 |
| Locus | 19q13, 1 |
| Discovery year | 2001-06-22 |
| GenBank acession | X02812 |
| Entrez gene record | 7040 |
| Pubmed identfication | 10631145 10843814 |
| Classification | Endogenous ligands |
| Havana BLAST/BLAT | OTTHUMG00000182760 |