Name : Recombinant Mouse Tumor Necrosis Factor Receptor II, TNFRSF1B, CD120b (C-6His)
Supplier : NOVO
Price :1613
SKU : GEN6259917254
| Reacts with | Mouse |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Mouse Tumor Necrosis Factor Receptor II is produced by our Mammalian expression system and the target gene encoding Val23-Gly258 is expressed with a 6His tag at the C-terminus |
| Molecular Weight | 26, 4 kD |
| UniProt number | Q545P4 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | VPAQVVLTPYKPEPGYECQISQEYYDRKAQMCCAKCPPGQYVKHFCNKTSDTVCADCEASMYTQVWNQFRTCLSCSSSCTTDQVEIRACTKQQNRVCACEAGRYCALKTHSGSCRQCMRLSKCGPGFGVASSRAPNGNVLCKACAPGTFSDTTSSTDVCRPHRICSILAIPGNASTDAVCAPESPTLSAIPRTLYVSQPEPTRSQPLDQEPGPSQTPSILTSLGSTPIIEQSTKGGVDHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Test | A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or  |
| Latin name | Mus musculus |
| Group | recombinants |
| Gene target | CD120b (C-6His), TNFRSF1B, Tumor Necrosis Factor Receptor II |
| Short name | CD120b (C-6His), TNFRSF1B, Recombinant Mouse Tumor Necrosis Factor Receptor II |
| Technique | E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Mouses, Mouse |
| Alternative name | CD120b (C-6His), member 1B, tumor necrosis factor receptor superfamily, recombinant Mouse Tumor Necrosis Factor Receptor II |
| Alternative technique | rec |
| Alternative to gene target | CD120b and p75 and p75TNFR and TBPII and TNF-R-II and TNF-R75 and TNFBR and TNFR1B and TNFR2 and TNFR80, TNFRSF1B and IDBG-632369 and ENSBTAG00000024928 and 338033, TNFRSF1B and IDBG-90091 and ENSG00000028137 and 7133, Tnfrsf1b and IDBG-203277 and ENSMUSG00000028599 and 21938, member 1B, nuclei, this GO :0005031 and tumor necrosis factor-activated receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005634 and nucleus and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006954 and inflammatory response and biological process this GO :0006955 and immune response and biological process this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0007568 and aging and biological process this GO :0008630 and intrinsic apoptotic signaling pathway in response to DNA damage and biological process this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0030424 and axon and cellular component this GO :0031625 and ubiquitin protein ligase binding and molecular function this GO :0032496 and response to lipopolysaccharide and biological process this GO :0043025 and neuronal cell body and cellular component this GO :0043196 and varicosity and cellular component this GO :0045087 and innate immune response and biological process this GO :0045121 and membrane raft and cellular component this GO :0048471 and perinuclear region of cytoplasm and cellular component this GO :0050728 and negative regulation of inflammatory response and biological process this GO :0050779 and RNA destabilization and biological process this GO :0051044 and positive regulation of membrane protein ectodomain proteolysis and biological process this GO :0071222 and cellular response to lipopolysaccharide and biological process this GO :0071363 and cellular response to growth factor stimulus and biological process this GO :0097191 and extrinsic apoptotic signaling pathway and biological process, this GO :0005031: tumor necrosis factor-activated receptor activity, this GO :0005031: tumor necrosis factor-activated receptor activity and also this GO :0005515: protein binding and also this GO :0031625: ubiquitin protein ligase binding, this GO :0005515: protein binding, this GO :0031625: ubiquitin protein ligase binding, ubiquitin protein ligase binding, tumor necrosis factor receptor superfamily |
| Identity | 11917 |
| Gene | TNFRSF1B |
| Long gene name | TNF receptor superfamily member 1B |
| Synonyms gene | TNFR2 |
| Synonyms gene name | member 1B , tumor necrosis factor receptor superfamily |
| Synonyms | TNFBR TNFR80 TNF-R75 TNF-R-II p75 CD120b |
| Locus | 1p36, 22 |
| Discovery year | 1991-01-15 |
| GenBank acession | M32315 |
| Entrez gene record | 7133 |
| Pubmed identfication | 2158863 8702885 |
| RefSeq identity | NM_001066 |
| Classification | CD molecules Tumor necrosis factor receptor superfamily |
| Havana BLAST/BLAT | OTTHUMG00000001829 |