Recombinant Mouse V-Set and Ig Domain-Containing Protein 8, VSIG8 (C-6His)

Recombinant Mouse V-Set and Ig Domain-Containing Protein 8, VSIG8 (C-6His) size: 500 µg 1613

Price 1613

Size 500 µg

Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit

Reacts with	Mouse
Source	proteins, Recombinants or rec
Description	Recombinant Mouse V-set and Immunoglobulin Domain-containing Protein 8 is produced by our Mammalian expression system and the target gene encoding Val22-Gly262 is expressed with a 6His tag at the C-terminus
Molecular Weight	27, 6 kD
UniProt number	Q6P3A4
State of the product	Liquid
Shipping conditions	Dry Ice/ice packs
Formulation	10% Glycerol, pH7, 2 um filtered solution of phosphate buffered saline, 4, Supplied as a 0
Storage recommendations	-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Purity	and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid	VRINGDGQEVMYLAEGDNVRLGCPYLLDPEDLGTNSLDIEWMQVNSEPSHRENVFLTYQDKRIGHGNLPHLQQRVRFAASDPSQYDASINLMNLQVSDTATYECRVKKTTMATRKVIVTVQARPAVPMCWTEGHMSKGNDVVLKCFANGGSQPLSYKWAKISGHSHPYRAGAYHSQHSFHSELSYQESFHSTINQGLGNGDLLLKGINADDDGLYQCTVANHVGYSVCVVEVKVSDSQRVGHHHHHH
Levels of endotoxin	11 IEU/ug, LAL test shows less than than 0
Test	A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or
Latin name	Mus musculus
Group	recombinants
Gene target	VSIG8 (C-6His), V-Set Ig Domain Protein 8
Short name	VSIG8 (C-6His), Recombinant Mouse V-Set Ig Domain- Protein 8
Technique	E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species	Mouses, Mouse
Alternative name	V-set and immunoglobulin domain containing 8 (C-6His), recombinant Mouse V-Set and Ig Domain-Containing Protein 8
Alternative technique	rec
Alternative to gene target	Plasma membranes, VSIG8 and IDBG-409230 and ENSG00000243284 and 391123, VSIG8 and IDBG-630698 and ENSBTAG00000010670 and 520493, Vsig8 and IDBG-205594 and ENSMUSG00000049598 and 240916, poly(A) RNA binding, this GO :0005515 and protein binding and molecular function this GO :0005622 and intracellular and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0044822 and poly(A) RNA binding and molecular function, this GO :0005515: protein binding, this GO :0005515: protein binding and also this GO :0044822: poly(A) RNA binding, this GO :0044822: poly(A) RNA binding, V-set and immunoglobulin domain containing 8
Identity	32063
Gene	VSIG8
Long gene name	V-set and immunoglobulin domain containing 8
Locus	1q23, 2
Discovery year	2005-12-01
Entrez gene record	391123
RefSeq identity	NM_001013661
Classification	V-set domain containing
Havana BLAST/BLAT	OTTHUMG00000168834

Recombinant Mouse V-Set and Ig Domain-Containing Protein 8, VSIG8 (C-6His)

Recombinant Mouse V-Set and Ig Domain-Containing Protein 8, VSIG8 (C-6His) size: 500 µg 1613

Similar products

Subscribe to our Newsletter