Name : Recombinant Mouse VSIG4 (C-6His)
Supplier : NOVO
Price :1186
SKU : GEN6300179683
| Reacts with | Mouse |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Mouse V-Set and Ig Domain-Containing Protein 4 is produced by our Mammalian expression system and the target gene encoding His20-Pro187 is expressed with a 6His tag at the C-terminus |
| Molecular Weight | 19, 7 kD |
| UniProt number | F6TUL9 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | HPTLKTPESVTGTWKGDVKIQCIYDPLRGYRQVLVKWLVRHGSDSVTIFLRDSTGDHIQQAKYRGRLKVSHKVPGDVSLQINTLQMDDRNHYTCEVTWQTPDGNQVIRDKIIELRVRKYNPPRINTEAPTTLHSSLEATTIMSSTSDLTTNGTGKLEETIAGSGRNLPHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Test | A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or  |
| Latin name | Mus musculus |
| Group | recombinants |
| Gene target | VSIG4 (C-6His) |
| Short name | Recombinant Mouse VSIG4 (C-6His) |
| Technique | E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Mouses, Mouse |
| Alternative name | recombinant Mouse V-set and immunoglobulin domain containing 4 (C-6His) |
| Alternative technique | rec |
| Alternative to gene target | CRIg and Z39IG, Plasma membranes, VSIG4 and IDBG-637672 and ENSBTAG00000015769 and 614262, VSIG4 and IDBG-73541 and ENSG00000155659 and 11326, Vsig4 and IDBG-160903 and ENSMUSG00000044206 and 278180, alternative pathway and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0032703 and negative regulation of interleukin-2 production and biological process this GO :0042130 and negative regulation of T cell proliferation and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, protein binding, this GO :0005515 and protein binding and molecular function this GO :0006957 and complement activation, this GO :0005515: protein binding, this GO :0005515: protein binding, V-set and immunoglobulin domain containing 4 |
| Identity | 17032 |
| Gene | VSIG4 |
| Long gene name | V-set and immunoglobulin domain containing 4 |
| Synonyms | Z39IG |
| Locus | Xq12 |
| Discovery year | 2004-09-10 |
| GenBank acession | AJ132502 |
| Entrez gene record | 11326 |
| Pubmed identfication | 11004523 17016555 17016562 |
| RefSeq identity | NM_007268 |
| Classification | V-set domain containing Immunoglobulin like domain containing |
| Havana BLAST/BLAT | OTTHUMG00000021727 |
| Locus Specific Databases | Mental Retardation database |