Name : Recombinant Rat Fibroblast Growth Factor 2, FGF2, FGFb
Supplier : NOVO
Price :1613
SKU : GEN2197449996
| Reacts with | Rat |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Rat Fibroblast growth factor 2 is produced by our E, coli expression system and the target gene encoding Ala11-Ser154 is expressed |
| Molecular Weight | 16, 2 kD |
| UniProt number | P13109 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | ALPEDGGGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| About | Rats , There are less rat- than mouse clones however, Rats are used to make rat monoclonal anti mouse antibodies, Rattus norvegicus are often studied in vivo as a model of human genes in Sprague-Dawley or Wistar rats, genes from rodents , of the genus  |
| Latin name | Rattus norvegicus |
| Group | recombinants |
| Gene target | FGF2, FGFb, Fibroblast Growth Factor 2 |
| Short name | FGF2, FGFb, Recombinant Fibroblast Growth Factor 2 |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Host | Rat |
| Species | Rats, Rat |
| Alternative name | FGFb, fibroblast growth factor 2 (basic), recombinant Rat Fibroblast Growth Factor 2 |
| Alternative technique | rec |
| Alternative to gene target | BFGF and FGF-2 and FGFB and HBGF-2, BT, DNA-templated and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0046668 and regulation of retinal cell programmed cell death and biological process this GO :0048011 and neurotrophin TRK receptor signaling pathway and biological process this GO :0048015 and phosphatidylinositol-mediated signaling and biological process this GO :0048598 and embryonic morphogenesis and biological process this GO :0048661 and positive regulation of smooth muscle cell proliferation and biological process this GO :0048678 and response to axon injury and biological process this GO :0048864 and stem cell development and biological process this GO :0050679 and positive regulation of epithelial cell proliferation and biological process this GO :0050918 and positive chemotaxis and biological process this GO :0051209 and release of sequestered calcium ion into cytosol and biological process this GO :0051726 and regulation of cell cycle and biological process this GO :0051781 and positive regulation of cell division and biological process this GO :0051897 and positive regulation of protein kinase B signaling and biological process this GO :0060045 and positive regulation of cardiac muscle cell proliferation and biological process this GO :0060128 and corticotropin hormone secreting cell differentiation and biological process this GO :0060129 and thyroid-stimulating hormone-secreting cell differentiation and biological process this GO :0060548 and negative regulation of cell death and biological process this GO :0060591 and chondroblast differentiation and biological process this GO :0060644 and mammary gland epithelial cell differentiation and biological process this GO :0060978 and angiogenesis involved in coronary vascular morphogenesis and biological process this GO :0061045 and negative regulation of wound healing and biological process this GO :0070374 and positive regulation of ERK1 and ERK2 cascade and biological process this GO :0090263 and positive regulation of canonical Wnt signaling pathway and biological process, FGF2 and IDBG-37039 and ENSG00000138685 and 2247, Fgf2 and IDBG-140464 and ENSMUSG00000037225 and 14173, chemoattractant activity, nuclei, this GO :0000186 and activation of MAPKK activity and biological process this GO :0000187 and activation of MAPK activity and biological process this GO :0001525 and angiogenesis and biological process this GO :0001658 and branching involved in ureteric bud morphogenesis and biological process this GO :0001759 and organ induction and biological process this GO :0001934 and positive regulation of protein phosphorylation and biological process this GO :0001938 and positive regulation of endothelial cell proliferation and biological process this GO :0002042 and cell migration involved in sprouting angiogenesis and biological process this GO :0005104 and fibroblast growth factor receptor binding and molecular function this GO :0005125 and cytokine activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0006661 and phosphatidylinositol biosynthetic process and biological process this GO :0006935 and chemotaxis and biological process this GO :0007165 and signal transduction and biological process this GO :0007173 and epidermal growth factor receptor signaling pathway and biological process this GO :0007265 and Ras protein signal transduction and biological process this GO :0007399 and nervous system development and biological process this GO :0007568 and aging and biological process this GO :0008083 and growth factor activity and molecular function this GO :0008201 and heparin binding and molecular function this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0008286 and insulin receptor signaling pathway and biological process this GO :0008543 and fibroblast growth factor receptor signaling pathway and biological process this GO :0009792 and embryo development ending in birth or egg hatching and biological process this GO :0009887 and organ morphogenesis and biological process this GO :0010001 and glial cell differentiation and biological process this GO :0010595 and positive regulation of endothelial cell migration and biological process this GO :0010628 and positive regulation of gene expression and biological process this GO :0010764 and negative regulation of fibroblast migration and biological process this GO :0010863 and positive regulation of phospholipase C activity and biological process this GO :0021762 and substantia nigra development and biological process this GO :0021940 and positive regulation of cerebellar granule cell precursor proliferation and biological process this GO :0030198 and extracellular matrix organization and biological process this GO :0030214 and hyaluronan catabolic process and biological process this GO :0030324 and lung development and biological process this GO :0030374 and ligand-dependent nuclear receptor transcription coactivator activity and molecular function this GO :0032958 and inositol phosphate biosynthetic process and biological process this GO :0038095 and Fc-epsilon receptor signaling pathway and biological process this GO :0042056 and chemoattractant activity and molecular function this GO :0042060 and wound healing and biological process this GO :0042660 and positive regulation of cell fate specification and biological process this GO :0043536 and positive regulation of blood vessel endothelial cell migration and biological process this GO :0043537 and negative regulation of blood vessel endothelial cell migration and biological process this GO :0043552 and positive regulation of phosphatidylinositol 3-kinase activity and biological process this GO :0045087 and innate immune response and biological process this GO :0045597 and positive regulation of cell differentiation and biological process this GO :0045669 and positive regulation of osteoblast differentiation and biological process this GO :0045765 and regulation of angiogenesis and biological process this GO :0045766 and positive regulation of angiogenesis and biological process this GO :0045893 and positive regulation of transcription, this GO :0005104: fibroblast growth factor receptor binding, this GO :0005104: fibroblast growth factor receptor binding and also this GO :0005125: cytokine activity and also this GO :0005515: protein binding and also this GO :0008083: growth factor activity and also this GO :0008201: heparin binding and also this GO :0030374: ligand-dependent nuclear receptor transcription coactivator activity and also this GO :0042056: chemoattractant activity, this GO :0005125: cytokine activity, this GO :0005515: protein binding, this GO :0008083: growth factor activity, this GO :0008201: heparin binding, this GO :0030374: ligand-dependent nuclear receptor transcription coactivator activity, this GO :0042056: chemoattractant activity, 66957 and IDBG-630303 and ENSBTAG00000005691 and 281161, fibroblast growth factor 2 (basic) |
| Identity | 3676 |
| Gene | FGF2 |
| Long gene name | fibroblast growth factor 2 |
| Synonyms gene | FGFB |
| Synonyms gene name | fibroblast growth factor 2 (basic) |
| Locus | 4q28, 1 |
| Discovery year | 1986-01-01 |
| GenBank acession | J04513 |
| Entrez gene record | 2247 |
| Pubmed identfication | 9925931 |
| RefSeq identity | NM_002006 |
| Classification | Endogenous ligands |
| Havana BLAST/BLAT | OTTHUMG00000039506 |