Name : Recombinant Rat Interleukin-1 Alpha, IL-1α
Supplier : NOVO
Price :2486
SKU : GEN6820974701
| Reacts with | Rat |
| Source | proteins, Recombinants or rec |
| Description | IL-1&alpha, is a &alpha, - or alpha protein sometimes glycoprotein present in blood, The Recombinant Interleukin-1 Alpha |
| Molecular Weight | 17, 9 kD |
| UniProt number | P16598 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | MSAPHSFQNNLRYKLIRIVKQEFIMNDSLNQNIYVDMDRIHLKAASLNDLQLEVKFDMYAYSSGGDDSKYPVTLKVSNTQLFVSAQGEDKPVLLKEIPETPKLITGSETDLIFFWEKINSKNYFTSAAFPELLIATKEQSQVHLARGLPSMIDFQIS |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| About | Rats , There are less rat- than mouse clones however, Rats are used to make rat monoclonal anti mouse antibodies, Rattus norvegicus are often studied in vivo as a model of human genes in Sprague-Dawley or Wistar rats, genes from rodents , of the genus  |
| Latin name | Rattus norvegicus |
| Group | recombinants |
| Gene target | IL-1&alpha, Interleukin-1 Alpha |
| Short name | IL-1&alpha, Recombinant Interleukin-1 Alpha |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Host | Rat |
| Species | Rats |
| Alternative name | Interleukin-1&alpha, recombinant Rat Interleukin-1 a |
| Alternative technique | rec |