Name : Recombinant Rat VEGF-A, VEGF164
Supplier : NOVO
Price :496
SKU : GEN5910942616
| Reacts with | Rat |
| Source | proteins, Recombinants or rec |
| Description | Recombinant Rat Vascular Endothelial Growth Factor A is produced by our Yeast expression system and the target gene encoding Ala27-Arg190 is expressed |
| Molecular Weight | 19, 2 kD |
| UniProt number | P16612-2 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | pH 7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | APTTEGEQKTHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNVTMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| About | Rats , There are less rat- than mouse clones however, Rats are used to make rat monoclonal anti mouse antibodies, Rattus norvegicus are often studied in vivo as a model of human genes in Sprague-Dawley or Wistar rats, genes from rodents , of the genus  |
| Latin name | Rattus norvegicus |
| Group | recombinants |
| Gene target | VEGF164, VEGF-A |
| Short name | VEGF164, Recombinant VEGF-A |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Host | Rat |
| Species | Rats, Rat |
| Alternative name | VEGF164, recombinant Rat VEGF-A |
| Alternative technique | rec |
| Identity | 12680 |
| Gene | VEGFA |
| Long gene name | vascular endothelial growth factor A |
| Synonyms gene | VEGF |
| Synonyms gene name | vascular endothelial growth factor |
| Synonyms | VEGF-A VPF |
| Locus | 6p21, 1 |
| Discovery year | 1994-01-10 |
| GenBank acession | AB021221 |
| Entrez gene record | 7422 |
| Pubmed identfication | 8786112 |
| RefSeq identity | NM_001025366 |
| Classification | VEGF family |
| Havana BLAST/BLAT | OTTHUMG00000014745 |
| Locus Specific Databases | ALSOD, the Amyotrophic Lateral Sclerosis Online Genetic Database |