Name : Recombinant S. cerevisiae TIM16
Supplier : NOVO
Price :202
SKU : GEN6029281784
| Reacts with | cerevisiae, S |
| Source | proteins, Recombinants or rec |
| Description | cerevisiae Mitochondrial Import Inner Membrane Translocase Subunit TIM16 is produced by our E, Recombinant S, coli expression system and the target gene encoding Thr54-Ala119 is expressed |
| Molecular Weight | 7, 9 kD |
| UniProt number | P42949 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 2 um filtered solution of 20 mM Tris, 300 mM sodium chloride, Lyophilized from a 0, pH8 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | MTLDESCKILNIEESKGDLNMDKINNRFNYLFEVNDKEKGGSFYLQSKVYRAAERLKWELAQREKNA |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Group | recombinants |
| Gene target | cerevisiae TIM16, S |
| Short name | cerevisiae TIM16, Recombinant S |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Alternative name | cerevisiae TIM16, recombinant S |
| Alternative technique | rec |
| Identity | 29679 |
| Gene | PAM16 |
| Long gene name | presequence translocase associated motor 16 homolog |
| Synonyms gene name | cerevisiae) , presequence translocase-associated motor 16 homolog (S |
| Synonyms | Magmas Tim16 TIMM16 |
| Synonyms name | mitochondria associated protein involved in granulocyte macrophage colony stimulating factor signal transduction |
| Locus | 16p13, 3 |
| Discovery year | 2010-09-01 |
| GenBank acession | AK026514 |
| Entrez gene record | 51025 |
| Pubmed identfication | 10810093 11750097 |
| RefSeq identity | NM_016069 |
| Havana BLAST/BLAT | OTTHUMG00000129466 |