Name : Recombinant Vaccinia Virus Soluble Interferon α, β receptor B18
Supplier : NOVO
Price :1613
SKU : GEN2061071979
| Reacts with | Vacciniavirus |
| Source | proteins, Recombinants or rec |
| Description | 2 or 3 and , However, In this sense, When such chemical-signals couple or bind to a receptor, a change in the electrical-activity of a cell, acetylcholine, am olfactory receptor is a protein-molecule that recognizes and responds to , an acetylcholine-receptor recognizes and responds to its endogenous-ligand, chemokinesor cytokines e, e, sometimes in pharmacology, such as enzymes, the term is also used to include other proteins that are drug-targets, they cause some form of cellular/tissue-response, transporters and ion-channels, The receptors are ligand binding factors of type 1, endogenous-chemical signals, g, g, protein-molecules , that receive chemical-signals from outside a cell |
| Molecular Weight | 2 kD, 39 |
| UniProt number | P25213 |
| State of the product | Freeze-dried |
| Shipping conditions | Ambient temperature |
| Formulation | 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7 |
| Storage recommendations | -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution | Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity | and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid | HSYAIDIENEITEFFNKMRDTLPAKDSKWLNPACMFGGTMNDIAALGEPFSAKCPPIEDSLLSHRYKDYVVKWERLEKNRRRQVSNKRVKHGDLWIANYTSKFSNRRYLCTVTTKNGDCVQGIVRSHIRKPPSCIPKTYELGTHDKYGIDLYCGILYAKHYNNITWYKDNKEINIDDIKYSQTGKELIIHNPELEDSGRYDCYVHYDDVRIKNDIVVSRCKILTVIPSQDHRFKLILDPKINVTIGEPANITCTAVSTSLLIDDVLIEWENPSGWLIGFDFDVYSVLTSRGGITEATLYFENVTEEYIGNTYKCRGHNYYFEKTLTTTVVLEHHHHHH |
| Levels of endotoxin | 11 IEU/ug, LAL test shows less than than 0 |
| Group | recombinants |
| Gene target | &beta, receptor B18, Vaccinia Virus Soluble Interferon &alpha |
| Short name | &beta, receptor B18, Recombinant Vaccinia Virus Soluble Interferon &alpha |
| Technique | E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species | Viruses |
| Alternative name | &beta, receptor B18, recombinant Vaccinia Virus Soluble Interferon &alpha |
| Alternative technique | rec |
| Identity | 7702 |
| Gene | NDUFB7 |
| Long gene name | NADH:ubiquinone oxidoreductase subunit B7 |
| Synonyms gene name | 18kDa , 7, 7 (18kD, B18) NADH dehydrogenase (ubiquinone) 1 beta subcomplex, NADH dehydrogenase (ubiquinone) 1 beta subcomplex |
| Synonyms | B18 CI-B18 MGC2480 |
| Synonyms name | NADH-ubiquinone oxidoreductase B18 subunit complex I B18 subunit |
| Locus | 19p13, 12 |
| Discovery year | 1997-12-09 |
| Entrez gene record | 4713 |
| Pubmed identfication | 9763677 10830904 |
| RefSeq identity | NM_004146 |
| Classification | NADH:ubiquinone oxidoreductase supernumerary subunits |
| Havana BLAST/BLAT | OTTHUMG00000183291 |