Filters

RNF2 Antibody / RING1B

RNF2 Antibody / RING1B size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenRNF2 / RING1B
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications IHC-P, WB
Recommended dilutions1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
NotesOptimal dilution of the RNF2 antibody should be determined by the researcher
Intented useThis RNF2 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #Q99496
PurityAntigen affinity
Description It has been shown to interact with, Polycomb group (PcG) of proteins form the multiprotein complexes that are important for the transcription repression of various genes involved in development and cell proliferation, Studies of the mouse counterpart suggested the involvement of this gene in the specification of anterior-posterior axis, The protein encoded by this gene is one of the PcG proteins, This protein was also found to interact with huntingtin interacting protein 2 (HIP2), an ubiquitin-conjugating enzyme, and possess ubiquitin ligase activity, and suppress the activity of, as well as in cell proliferation in early development, transcription factor CP2 (TFCP2/CP2), E3 ubiquitin-protein ligase RING2/RING1B is an enzyme that in humans is encoded by the RNF2 gene
ImmunogenAmino acids DHLSKYLAVRLALEELRSKGESNQMNLDTASEKQ of human RNF2 were used as the immunogen for the RNF2 antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the RNF2 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
LocalizationNuclear
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetRNF2 / RING1B
Short nameRNF2 Antibody / RING1B
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameRNF2 (Antibody to) / RING1B
Alternative techniqueantibodies
Identity 10061
Gene RNF2
Long gene name ring finger protein 2
Synonyms BAP-1 BAP1 DING HIPI3 RING1B RING2
Locus 1q25, 3
Discovery year 1997-06-09
GenBank acession BC012583 Y10571
Entrez gene record 6045
Pubmed identfication 11513855
RefSeq identity NM_007212
Classification Ring finger proteins
Havana BLAST/BLAT OTTHUMG00000035391

Similar products

Subscribe to our Newsletter