Filters

RPA70 Antibody / RPA1

RPA70 Antibody / RPA1 size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenRPA70 / RPA1
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applicationsWB
Recommended dilutions1-0, 5ug/ml, Western blot: 0
NotesOptimal dilution of the RPA1 antibody should be determined by the researcher
Intented useThis RPA1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #P27694
PurityAntigen affinity
Description 32-kD (RPA2), It had been found that recombinant human RPA1, It is composed of 70-kD (RPA1), RPA1 could substitute for the complete complex in stimulating the activity of DNA polymerase alpha-primase, Replication protein A (RPA) is a heterotrimeric single-strand DNA (ssDNA)-binding protein essential for DNA replication, The RPA complex was originally isolated as a factor essential for in vitro replication of the papovavirus SV40, The RPA1 subunit is responsible for high-affinity ssDNA binding, This gene is mapped to chromosome 17p13, and 14-kD (RPA3) subunits, and recombination, but it could not substitute for the complete complex in SV40 DNA replication in vitro, exhibited ssDNA-binding activity comparable to that of the complete RPA complex, purified from bacteria, repair, suggesting an important functional role for the other subunits, 3, Replication protein A 70 kDa DNA-binding subunit is a protein that in humans is encoded by the RPA1 gene
ImmunogenAmino acids QESAEAILGQNAAYLGELKDKNEQAFEEVFQNANFR of human RPA1 were used as the immunogen for the RPA1 antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the RPA1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetRPA70 / RPA1
Short nameRPA70 Antibody / RPA1
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameRPA70 (Antibody to) / RPA1
Alternative techniqueantibodies
Identity 10289
Gene RPA1
Long gene name replication protein A1
Synonyms gene name 70kDa , replication protein A1 (70kD) replication protein A1
Synonyms REPA1 RPA70 HSSB RF-A RP-A
Locus 17p13, 3
Discovery year 1993-12-14
GenBank acession M63488
Entrez gene record 6117
Pubmed identfication 8454588
RefSeq identity NM_002945
Classification Nucleotide excision repair
Havana BLAST/BLAT OTTHUMG00000090579

Similar products

Subscribe to our Newsletter