Filters

SCTR Antibody

SCTR Antibody size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenSCTR
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applicationsWB
Recommended dilutions5-1ug/ml, Western blot: 0
Added buffer025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2
Intented useThis SCTR antibodyis to be used only for research purposes and not for diagnostics
Uniprot #P47872
PurityAntigen affinity
Description It binds secretin which is the most potent regulator of pancreatic bicarbonate, Secretin and its receptor are suggested to be involved in pancreatic cancer and autism, The SCTR gene is mapped to chromosome 2q14, electrolyte and volume secretion, 1 by fluorescence in situ hybridization, Human secretin receptor (gene name SCTR) is a G protein-coupled receptor and belongs to the glucagon-VIP-secretin receptor family
ImmunogenAmino acids 398-440 (EVQKKWQQWHLREFPLHPVASFSNSTKASHLEQSQGTCRTSII) from the human protein were used as the immunogen for the SCTR antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the SCTR antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetSCTR
Short nameSCTR Antibody
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameSCTR (Antibody to)
Alternative techniqueantibodies
Identity 10608
Gene SCTR
Long gene name secretin receptor
Locus 2q14, 2
Discovery year 1994-01-27
Entrez gene record 6344
Pubmed identfication 1646711
Classification Glucagon receptor family
Havana BLAST/BLAT OTTHUMG00000131407

Similar products

Subscribe to our Newsletter