Filters

SOX5 Antibody

SOX5 Antibody size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenSOX5
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applicationsWB
Recommended dilutions1-0, 5ug/ml, Western blot: 0
NotesOptimal dilution of the SOX5 antibody should be determined by the researcher
Intented useThis SOX5 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #P35711
PurityAntigen affinity
Description A pseudogene of this gene is located on chromosome 8, In addition, It is located on 12p12, Multiple transcript variants encoding distinct isoforms have been identified for this gene, The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins, This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate, the encoded protein may play a role in chondrogenesis, 1, Transcription factor SOX-5 is a protein that in humans is encoded by the SOX5 gene
ImmunogenAmino acids EKEKTTLESLTQQLAVKQNEEGKFSHAMMDFNLS of human SOX5 were used as the immunogen for the SOX5 antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the SOX5 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetSOX5
Short nameSOX5 Antibody
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameSOX5 (Antibody to)
Alternative techniqueantibodies
Identity 11201
Gene SOX5
Long gene name SRY-box 5
Synonyms gene name SRY (sex determining region Y)-box 5 SRY box 5
Synonyms L-SOX5 MGC35153
Locus 12p12, 1
Discovery year 1997-07-07
GenBank acession AB081589
Entrez gene record 6660
Pubmed identfication 8812465
RefSeq identity NM_006940
Classification SRY-boxes
Havana BLAST/BLAT OTTHUMG00000169026

Similar products

Subscribe to our Newsletter