Filters

Srb1 Antibody

Srb1 Antibody size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenSrb1
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Mouse (Mus musculus)
Tested applicationsWB
Recommended dilutions1-0, 5ug/ml, Western blot: 0
NotesOptimal dilution of the Srb1 antibody should be determined by the researcher
Intented useThis Srb1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #Q61009
PurityAntigen affinity
Description It is best known for its role in facilitating the uptake of cholesteryl esters from high-density lipoproteins in the liver, SR-BI functions as a receptor for high-density lipoprotein, SR-BI has also been identified in the livers of non-mammalian species (turtle, Scavenger receptor class B, The turtle also seems to upregulate SB-RI during egg development, This movement of cholesterol is known as reverse cholesterol transport and is a protective mechanism against the development of atherosclerosis, This process drives the movement of cholesterol from peripheral tissues towards the liver for excretion, also known as SR-BI, and skate), chicken, frog, goldfish, including the liver and adrenal, indicating that cholesterol efflux may be at peak levels during developmental stages, is a protein that in humans is encoded by the SCARB1 gene, shark, suggesting it emerged early in vertebrate evolutionary history, type I (SR-BI) is an integral membrane protein found in numerous cell types/tissues, which is the principal cause of heart disease and stroke, Scavenger receptor class B member 1 (SRB1)
ImmunogenAmino acids KKGSQDKEAIQAYSESLMSPAAKGTVLQEAKL of mouse Srb1 were used as the immunogen for the Srb1 antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the Srb1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetSrb1
Short nameSrb1 Antibody
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameSrb1 (Antibody to)
Alternative techniqueantibodies
Identity 1664
Gene SCARB1
Long gene name scavenger receptor class B member 1
Synonyms gene CD36L1
Synonyms gene name CD36 antigen (collagen type I receptor, member 1 , thrombospondin receptor)-like 1 scavenger receptor class B
Synonyms SRB1 CLA-1 CLA1 SR-BI
Locus 12q24, 31
Discovery year 1994-09-06
GenBank acession Z22555
Entrez gene record 949
Pubmed identfication 7689561
RefSeq identity NM_005505
Classification Scavenger receptors
Havana BLAST/BLAT OTTHUMG00000168544

Similar products

Subscribe to our Newsletter