Filters

STING Antibody / TMEM173

STING Antibody / TMEM173 size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenSTING / TMEM173
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications IHC-P, WB
Recommended dilutions1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
NotesOptimal dilution of the STING antibody should be determined by the researcher
Intented useThis STING antibodyis to be used only for research purposes and not for diagnostics
Uniprot #Q86WV6
PurityAntigen affinity
Description Also the encoded protein has been shown to play a role in apoptotic signaling by associating with type II major histocompatibility complex, Alternate splicing results in multiple transcript variants, Mutations in this gene are the cause of infantile-onset STING-associated vasculopathy, The encoded protein is a pattern recognition receptor that detects cytosolic nucleic acids and transmits signals that activate type I interferon responses, This gene encodes a five transmembrane protein that functions as a major regulator of the innate immune response to viral and bacterial infections, also called STING, is a protein that in humans is encoded by the TMEM173 gene, Transmembrane protein 173
ImmunogenAmino acids RLEQAKLFCRTLEDILADAPESQNNCRLIAYQE of human STING were used as the immunogen for the STING antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the STING antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
LocalizationCytoplasmic
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetSTING / TMEM173
Short nameSTING Antibody / TMEM173
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameSTING (Antibody to) / transmembrane protein 173
Alternative techniqueantibodies
Alternative to gene target Plasma membranes, TMEM173 and IDBG-47893 and ENSG00000184584 and 340061, TMEM173 and IDBG-646026 and ENSBTAG00000002296 and 533661, Tmem173 and IDBG-137341 and ENSMUSG00000024349 and 72512, cyclic-GMP-AMP binding, this GO :0002218 and activation of innate immune response and biological process this GO :0002230 and positive regulation of defense response to virus by host and biological process this GO :0005515 and protein binding and molecular function this GO :0005741 and mitochondrial outer membrane and cellular component this GO :0005777 and peroxisome and cellular component this GO :0005783 and endoplasmic reticulum and cellular component this GO :0005789 and endoplasmic reticulum membrane and cellular component this GO :0005794 and this GO lgi apparatus and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006915 and apoptotic process and biological process this GO :0008134 and transcription factor binding and molecular function this GO :0016021 and integral component of membrane and cellular component this GO :0019901 and protein kinase binding and molecular function this GO :0030659 and cytoplasmic vesicle membrane and cellular component this GO :0031625 and ubiquitin protein ligase binding and molecular function this GO :0032092 and positive regulation of protein binding and biological process this GO :0032479 and regulation of type I interferon production and biological process this GO :0032481 and positive regulation of type I interferon production and biological process this GO :0032608 and interferon-beta production and biological process this GO :0033160 and positive regulation of protein import into nucleus, this GO :0005515: protein binding, this GO :0005515: protein binding and also this GO :0008134: transcription factor binding and also this GO :0019901: protein kinase binding and also this GO :0031625: ubiquitin protein ligase binding and also this GO :0035438: cyclic-di-GMP binding and also this GO :0042802: identical protein binding and also this GO :0042803: protein homodimerization activity and also this GO :0061507: cyclic-GMP-AMP binding, this GO :0008134: transcription factor binding, this GO :0019901: protein kinase binding, this GO :0031625: ubiquitin protein ligase binding, this GO :0035438: cyclic-di-GMP binding, this GO :0042802: identical protein binding, this GO :0042803: protein homodimerization activity, this GO :0061507: cyclic-GMP-AMP binding, translocation and biological process this GO :0035438 and cyclic-di-GMP binding and molecular function this GO :0035458 and cellular response to interferon-beta and biological process this GO :0042802 and identical protein binding and molecular function this GO :0042803 and protein homodimerization activity and molecular function this GO :0042993 and positive regulation of transcription factor import into nucleus and biological process this GO :0045087 and innate immune response and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0048471 and perinuclear region of cytoplasm and cellular component this GO :0051607 and defense response to virus and biological process this GO :0061507 and cyclic-GMP-AMP binding and molecular function this GO :0071360 and cellular response to exogenous dsRNA and biological process, transmembrane protein 173
Identity 27962
Gene TMEM173
Long gene name transmembrane protein 173
Synonyms FLJ38577 NET23 ERIS MPYS STING MITA
Synonyms name stimulator of interferon genes
Locus 5q31, 2
Discovery year 2006-08-24
Entrez gene record 340061
Pubmed identfication 21947006
RefSeq identity NM_198282
Havana BLAST/BLAT OTTHUMG00000129239

Subscribe to our Newsletter