| Category | Antibody |
| Concentration | 2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form | Antigen affinity purified |
| Conjugation | Unconjugated |
| Clone | Polyclonal antibody |
| Recognised antigen | TGFBR1 / TGF beta Receptor I |
| Host animal | Rabbit (Oryctolagus cuniculus) |
| Clonality | Polyclonal (rabbit origin) |
| Species reactivity | Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications | WB |
| Recommended dilutions | 1-0, 5ug/ml, Western blot: 0 |
| Notes | Optimal dilution of the TGFBR1 antibody should be determined by the researcher |
| Intented use | This TGFBR1 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot # | P36897 |
| Purity | Antigen affinity |
| Description | Both are transmembrane serine/threonine receptor kinases, Mutations in this gene have been associated with Loeys-Dietz aortic aneurysm syndrome (LDAS), TGFB1 regulates cell cycle progression by a unique signaling mechanism that involves its binding to TGFBR2 and activation of TGFBR1, TGFBR1 is its human gene, The TGFBR1 receptor may be inactivated in many of the cases of human tumor cells refractory to TGFB-mediated cell cycle arrest, The organization of the segment of the gene that encodes the C-terminal portion of the serine/threonine kinase domain appears to be highly conserved among members of the gene family, The protein encoded by this gene forms a heteromeric complex with type II TGF-beta receptors when bound to TGF-beta, Vellucci and Reiss (1997) reported that the TGFBR1 gene is approximately 31 kb long and contains 9 exons, beta receptor I is a TGF beta receptor, transducing the TGF-beta signal from the cell surface to the cytoplasm, Transforming growth factor |
| Immunogen | Amino acids HNRTVIHHRVPNEEDPSLDRPFISEGTTLKDLIYDMTT of human TGFBR1 were used as the immunogen for the TGFBR1 antibody |
| Storage | Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the TGFBR1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties | C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target | TGFBR1 / TGF beta Receptor I |
| Short name | TGFBR1 Antibody / TGF beta Receptor I |
| Technique | antibodies against human proteins, antibodies for, Antibody |
| Alternative name | b receptor 1 (Antibody to) / TGF b Receptor I, transforming growth factor |
| Alternative technique | antibodies |
| Alternative to gene target | AAT5 and ACVRLK4 and ALK-5 and ALK5 and ESS1 and LDS1 and LDS1A and LDS2A and MSSE and SKR4 and TGFR-1, Cell surfaces, DNA-templated and biological process this GO :0006468 and protein phosphorylation and biological process this GO :0006915 and apoptotic process and biological process this GO :0007050 and cell cycle arrest and biological process this GO :0007165 and signal transduction and biological process this GO :0007178 and transmembrane receptor protein serine/threonine kinase signaling pathway and biological process this GO :0007179 and transforming growth factor beta receptor signaling pathway and biological process this GO :0007507 and heart development and biological process this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0008354 and germ cell migration and biological process this GO :0009435 and NAD biosynthetic process and biological process this GO :0009791 and post-embryonic development and biological process this GO :0009952 and anterior/posterior pattern specification and biological process this GO :0010468 and regulation of gene expression and biological process this GO :0010862 and positive regulation of pathway-restricted SMAD protein phosphorylation and biological process this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0016772 and transferase activity, DNA-templated and biological process this GO :0046332 and SMAD binding and molecular function this GO :0046872 and metal ion binding and molecular function this GO :0048538 and thymus development and biological process this GO :0048663 and neuron fate commitment and biological process this GO :0048701 and embryonic cranial skeleton morphogenesis and biological process this GO :0048705 and skeletal system morphogenesis and biological process this GO :0048762 and mesenchymal cell differentiation and biological process this GO :0048844 and artery morphogenesis and biological process this GO :0048870 and cell motility and biological process this GO :0050431 and transforming growth factor beta binding and molecular function this GO :0051272 and positive regulation of cellular component movement and biological process this GO :0051491 and positive regulation of filopodium assembly and biological process this GO :0051897 and positive regulation of protein kinase B signaling and biological process this GO :0060017 and parathyroid gland development and biological process this GO :0060021 and palate development and biological process this GO :0060037 and pharyngeal system development and biological process this GO :0060389 and pathway-restricted SMAD protein phosphorylation and biological process this GO :0060391 and positive regulation of SMAD protein import into nucleus and biological process this GO :0070022 and transforming growth factor beta receptor homodimeric complex and cellular component this GO :0070411 and I-SMAD binding and molecular function this GO :0070723 and response to cholesterol and biological process this GO :0071560 and cellular response to transforming growth factor beta stimulus and biological process this GO :2001235 and positive regulation of apoptotic signaling pathway and biological process this GO :2001237 and negative regulation of extrinsic apoptotic signaling pathway and biological process, TGFBR1 and IDBG-634152 and ENSBTAG00000018035 and 282382, TGFBR1 and IDBG-78488 and ENSG00000106799 and 7046, Tgfbr1 and IDBG-146050 and ENSMUSG00000007613 and 21812, beta receptor 1, this GO :0000186 and activation of MAPKK activity and biological process this GO :0001501 and skeletal system development and biological process this GO :0001525 and angiogenesis and biological process this GO :0001701 and in utero embryonic development and biological process this GO :0001822 and kidney development and biological process this GO :0001824 and blastocyst development and biological process this GO :0001837 and epithelial to mesenchymal transition and biological process this GO :0001937 and negative regulation of endothelial cell proliferation and biological process this GO :0002088 and lens development in camera-type eye and biological process this GO :0004514 and nicotinate-nucleotide diphosphorylase (carboxylating) activity and molecular function this GO :0004672 and protein kinase activity and molecular function this GO :0004674 and protein serine/threonine kinase activity and molecular function this GO :0004675 and transmembrane receptor protein serine/threonine kinase activity and molecular function this GO :0004702 and receptor signaling protein serine/threonine kinase activity and molecular function this GO :0004713 and protein tyrosine kinase activity and molecular function this GO :0005024 and transforming growth factor beta-activated receptor activity and molecular function this GO :0005025 and transforming growth factor beta receptor activity, this GO :0004514: nicotinate-nucleotide diphosphorylase (carboxylating) activity, this GO :0004514: nicotinate-nucleotide diphosphorylase (carboxylating) activity and also this GO :0004672: protein kinase activity and also this GO :0004674: protein serine/threonine kinase activity and also this GO :0004675: transmembrane receptor protein serine/threonine kinase activity and also this GO :0004702: receptor signaling protein serine/threonine kinase activity and also this GO :0004713: protein tyrosine kinase activity and also this GO :0005024: transforming growth factor beta-activated receptor activity and also this GO :0005025: transforming growth factor beta receptor activity, this GO :0004672: protein kinase activity, this GO :0004674: protein serine/threonine kinase activity, this GO :0004675: transmembrane receptor protein serine/threonine kinase activity, this GO :0004702: receptor signaling protein serine/threonine kinase activity, this GO :0004713: protein tyrosine kinase activity, this GO :0005024: transforming growth factor beta-activated receptor activity, this GO :0005025: transforming growth factor beta receptor activity, this GO :0005114: type II transforming growth factor beta receptor binding, this GO :0005515: protein binding, this GO :0005524: ATP binding, this GO :0016772: transferase activity, this GO :0019838: growth factor binding, this GO :0046332: SMAD binding, this GO :0046872: metal ion binding, this GO :0050431: transforming growth factor beta binding, this GO :0070411: I-SMAD binding, transferring phosphorus-containing groups, transferring phosphorus-containing groups and also this GO :0019838: growth factor binding and also this GO :0046332: SMAD binding and also this GO :0046872: metal ion binding and also this GO :0050431: transforming growth factor beta binding and also this GO :0070411: I-SMAD binding, transferring phosphorus-containing groups and molecular function this GO :0018105 and peptidyl-serine phosphorylation and biological process this GO :0018107 and peptidyl-threonine phosphorylation and biological process this GO :0019838 and growth factor binding and molecular function this GO :0023014 and signal transduction by phosphorylation and biological process this GO :0030199 and collagen fibril organization and biological process this GO :0030307 and positive regulation of cell growth and biological process this GO :0030512 and negative regulation of transforming growth factor beta receptor signaling pathway and biological process this GO :0031396 and regulation of protein ubiquitination and biological process this GO :0032331 and negative regulation of chondrocyte differentiation and biological process this GO :0042060 and wound healing and biological process this GO :0043062 and extracellular structure organization and biological process this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0043235 and receptor complex and cellular component this GO :0043393 and regulation of protein binding and biological process this GO :0043542 and endothelial cell migration and biological process this GO :0045893 and positive regulation of transcription, transforming growth factor beta receptor activity, type I, type I and also this GO :0005114: type II transforming growth factor beta receptor binding and also this GO :0005515: protein binding and also this GO :0005524: ATP binding and also this GO :0016772: transferase activity, type I and molecular function this GO :0005114 and type II transforming growth factor beta receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005524 and ATP binding and molecular function this GO :0005768 and endosome and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005923 and tight junction and cellular component this GO :0006355 and regulation of transcription, transforming growth factor |
| Identity | 11772 |
| Gene | TGFBR1 |
| Long gene name | transforming growth factor beta receptor 1 |
| Synonyms gene | MSSE ESS1 |
| Synonyms gene name | multiple self-healing squamous epithelioma transforming growth factor beta receptor I |
| Synonyms | ALK-5 ACVRLK4 ALK5 |
| Synonyms name | 53kDa , activin A receptor type II-like kinase |
| Locus | 9q22, 33 |
| Discovery year | 1993-09-30 |
| Entrez gene record | 7046 |
| Pubmed identfication | 1319842 8530052 21358634 |
| Classification | Type 1 receptor serine/threonine kinases |
| Havana BLAST/BLAT | OTTHUMG00000020353 |
| Locus Specific Databases | Belgium , Ghent, LOVD - Center for Medical Genetics |
Technique
Supplier
Species
Label
Iso Type
Host
Tissue