Filters

TIP47 Antibody / Perilipin 3 / M6PRBP1

TIP47 Antibody / Perilipin 3 / M6PRBP1 size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenTIP47 / Perilipin 3 / M6PRBP1
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications IHC-P, WB
Recommended dilutions5-1ug/ml, IHC (FFPE): 1-2ug/ml, Western blot: 0
Added buffer025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2
Intented useThis Perilipin 3 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #O60664
PurityAntigen affinity
Description Mannose 6-phophate receptors (MPRs) deliver lysosomal hydrolase from the Golgi to endosomes and then return to the Golgi complex, Multiple transcript variants encoding different isoforms have been found for this gene, The interaction with RAB9 has been shown to increase the affinity of this protein for its cargo, The protein encoded by this gene interacts with the cytoplasmic domains of both cation-independent and cation-dependent MPRs, This protein also binds directly to the GTPase RAB9 (RAB9A), a member of the RAS oncogene family, also known as Perilipin 3 (PLN3) or TIP47, and is required for endosome-to-Golgi transport, is a protein which in humans is encoded by the M6PRBP1 gene, Mannose-6-phosphate receptor binding protein 1 (M6PRBP1)
ImmunogenAmino acids ESRALTMFRDIAQQLQATCTSLGSSIQGLPTNVKDQVQQARRQ were used as the immunogen for the Perilipin 3 antibody
Storage After reconstitution, Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, store at 4oC, the Perilipin 3 antibody may be kept for up to one month refrigerated at +4 degrees C, For long-term, Prior to reconstitution
Localization membranous, Cytoplasmic
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetTIP47 / Perilipin 3 / M6PRBP1
Short nameTIP47 Antibody / Perilipin 3 / M6PRBP1
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameTIP47 (Antibody to) / Perilipin 3 / M6PRBP1
Alternative techniqueantibodies
Identity 16893
Gene PLIN3
Long gene name perilipin 3
Synonyms gene M6PRBP1
Synonyms gene name mannose-6-phosphate receptor binding protein 1
Synonyms TIP47 PP17
Synonyms name 47-KD , cargo selection protein (mannose 6 phosphate receptor binding protein) placental protein 17 MPR-BINDING PROTEIN
Locus 19p13, 3
Discovery year 2004-01-16
GenBank acession AF051314
Entrez gene record 10226
Pubmed identfication 9590177 6856484 19638644
RefSeq identity NM_005817
Classification Perilipins
Havana BLAST/BLAT OTTHUMG00000180249

Similar products

Subscribe to our Newsletter