Name : UBE2Q2 Antibody
Supplier : NJS POLY
Price :406
SKU : GEN5385225395
| Category | Antibody |
| Concentration | 2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form | Antigen affinity purified |
| Conjugation | Unconjugated |
| Clone | Polyclonal antibody |
| Recognised antigen | UBE2Q2 |
| Host animal | Rabbit (Oryctolagus cuniculus) |
| Clonality | Polyclonal (rabbit origin) |
| Species reactivity | Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications | IHC-P, WB |
| Recommended dilutions | 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes | Optimal dilution of the UBE2Q2 antibody should be determined by the researcher |
| Intented use | This UBE2Q2 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot # | Q8WVN8 |
| Purity | Antigen affinity |
| Description | Changes in cell cycle progression and viability are not observed in the absence of MIA treatment, Finally, Inhibition of UBE2Q2 in HeLa cells causes an early mitotic arrest and increases cytotoxicity when the cells are treated with microtubule-inhibiting agents (MIAs), It can covalently bind ubiquitin on the active site cysteine within the UBC domain, Its gene is mapped to 15q24, Moreover, indicating that UBE2Q2 is involved in the response to MIAs rather than performing a more general function in mitosis, inhibition of UBE2Q2 also sensitizes cells to the cytotoxic effects of MIAs through caspase-mediated apoptosis that is correlated with PARP1 cleavage, inhibition of the protein causes cells to undergo a prolonged prophase arrest, suggesting that UBE2Q2 normally functions to antagonize an early mitotic checkpoint, 2, UBE2Q2 is identified as a putative ubiquitin-conjugating enzyme (E2) in a microarray screen for mitotic regulatory proteins |
| Immunogen | Amino acids LERLEDTKNNNLLRQQLKWLICELCSLYNLPKHLDVEMLDQ of human UBE2Q2 were used as the immunogen for the UBE2Q2 antibody |
| Storage | Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the UBE2Q2 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization | Cytoplasmic |
| Properties | C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target | UBE2Q2 |
| Short name | UBE2Q2 Antibody |
| Technique | antibodies against human proteins, antibodies for, Antibody |
| Alternative name | UBE2Q2 (Antibody to) |
| Alternative technique | antibodies |
| Identity | 19248 |
| Gene | UBE2Q2 |
| Long gene name | ubiquitin conjugating enzyme E2 Q2 |
| Synonyms gene name | ubiquitin-conjugating enzyme E2Q (putative) 2 ubiquitin-conjugating enzyme E2Q family member 2 |
| Synonyms | DKFZp762C143 |
| Locus | 15q24, 2 |
| Discovery year | 2005-10-04 |
| GenBank acession | BC017708 |
| Entrez gene record | 92912 |
| Pubmed identfication | 16300736 |
| RefSeq identity | NM_173469 |
| Classification | Ubiquitin conjugating enzymes E2 |
| Havana BLAST/BLAT | OTTHUMG00000142839 |