Filters

UHRF2 Antibody / NIRF

UHRF2 Antibody / NIRF size: 0.1mg 406

Supplier NJS POLY
Price 406
Size 0.1mg
Contact us Ask Component cell markers and DNA bp. markers are genetic markerser genes or DNA sequenceswith selection audit
CategoryAntibody
Concentration2ml sterile DI water, 5mg/ml if reconstituted with 0
FormAntigen affinity purified
ConjugationUnconjugated
ClonePolyclonal antibody
Recognised antigenUHRF2 / NIRF
Host animalRabbit (Oryctolagus cuniculus)
ClonalityPolyclonal (rabbit origin)
Species reactivity Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications IHC-P, WB
Recommended dilutions1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
NotesOptimal dilution of the UHRF2 antibody should be determined by the researcher
Intented useThis UHRF2 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #Q96PU4
PurityAntigen affinity
Description Alternative splicing results in multiple transcript variants some of which are non-protein coding, The encoded protein contains an NIRF_N domain, The encoded protein is a ubiquitin-ligase capable of ubiquinating PCNP (PEST-containing nuclear protein), This gene encodes a nuclear protein which is involved in cell-cycle regulation, This protein may also have a role in intranuclear degradation of polyglutamine aggregates, a PHD finger, a set- and ring-associated (SRA) domain, and a RING finger domain and several of these domains have been shown to be essential for the regulation of cell proliferation, and together they may play a role in tumorigenesis, E3 ubiquitin-protein ligase UHRF2 is an enzyme that in humans is encoded by the UHRF2 gene
ImmunogenAmino acids TIEDVSRKATIEELRERVWALFDVRPECQRLFYRGKQLEN of human NIRF/UHRF2 were used as the immunogen for the UHRF2 antibody
Storage Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the UHRF2 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization minor nuclear, Cytoplasmic
PropertiesC, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene targetUHRF2 / NIRF
Short nameUHRF2 Antibody / NIRF
Technique antibodies against human proteins, antibodies for, Antibody
Alternative nameUHRF2 (Antibody to) / NIRF
Alternative techniqueantibodies
Identity 12557
Gene UHRF2
Long gene name ubiquitin like with PHD and ring finger domains 2
Synonyms gene name E3 ubiquitin protein ligase , ubiquitin-like with PHD and ring finger domains 2
Synonyms RNF107 NIRF URF2 MGC33463 TDRD23
Synonyms name Np95-like ring finger protein
Locus 9p24, 1
Discovery year 2000-03-15
GenBank acession AF274049
Entrez gene record 115426
Pubmed identfication 12176013
RefSeq identity NM_152306
Classification PHD finger proteins Ring finger proteins Tudor domain containing
Havana BLAST/BLAT OTTHUMG00000019521

Similar products

Subscribe to our Newsletter